LXL04_021699 | RubberDandelionOmics

Gene overview

LXL04_021699

Reference: OH-1004 Chr: Chr04 Coordinates: 135517899-135519532 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1311 bp · LXL04_021699|LXL04_021699|OH1004|cDNA

ATGGCATGGTACAGAAGATCAAAACTAGGTTTTGATGCAATTTCACGTCACTTCACCTCCAAAATCACCCCCTCCAAAAGCCACATCCCAAACGCAGCTTCTGTTATCAACCACAATCATCAATTGAGTAAGTTTACTTCTAGGGTTTCTAAAACTTCTATTTTTTCACCCGTAAGTGTCGATAGAATCTTGAAATTTCAATTACACGGAAGTGGTTATAGATATTACTATGTCGATTCACGACAAGTTAGGCATTTCAA...

CDS

Download CDS FASTA

1311 bp · LXL04_021699|LXL04_021699|OH1004|CDS

ATGGCATGGTACAGAAGATCAAAACTAGGTTTTGATGCAATTTCACGTCACTTCACCTCCAAAATCACCCCCTCCAAAAGCCACATCCCAAACGCAGCTTCTGTTATCAACCACAATCATCAATTGAGTAAGTTTACTTCTAGGGTTTCTAAAACTTCTATTTTTTCACCCGTAAGTGTCGATAGAATCTTGAAATTTCAATTACACGGAAGTGGTTATAGATATTACTATGTCGATTCACGACAAGTTAGGCATTTCAA...

Protein

Download Protein FASTA

436 aa · LXL04_021699|LXL04_021699|OH1004|PROTEIN

MAWYRRSKLGFDAISRHFTSKITPSKSHIPNAASVINHNHQLSKFTSRVSKTSIFSPVSVDRILKFQLHGSGYRYYYVDSRQVRHFKPRGFRSWSDNPKNILIVVLVGSGIGVTLYFGNVETIPYTKRRHLVLLSKNLERTIGESQFKNMKAGFKGKILPAIHPESVRVRLISKDIIESLQRGLKKDQVWTDLNYASETGAASENRGKETLMAMTEGTGGGENWPAKEEVLDDMWVDQSRKKGKEKGEKSATGHLEGLNW...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_021699`
TK1151 ID	TkA05G416450
OH-1004 ID	LXL04_021699
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_021699

Location Chr04:135517899-135519532 (-)

Description Similar to oma1: Mitochondrial metalloendopeptidase OMA1 (Schizosaccharomyces pombe (strain 972 / ATCC 24843)

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g51740`	Protease that is part of the quality control system in the inner membrane of mitochondria (By similarity).	AtOMA1 Affects the OXPHOS System and Plant Growth in Contrast to Other Newly Identified ATP-Independent Proteases in Arabidopsis Mitochondria.2017 · DOI: 10.3389/fpls.2017.01543

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021699 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002024 diet induced thermogenesis Biological Process

GO:0006006 glucose metabolic process Biological Process

GO:0006515 protein quality control for misfolded or incompletely synthesized proteins Biological Process

GO:0006629 lipid metabolic process Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0010637 negative regulation of mitochondrial fusion Biological Process

GO:0016540 protein autoprocessing Biological Process

GO:0031638 zymogen activation Biological Process

GO:0031929 TOR signaling Biological Process

GO:0033108 mitochondrial respiratory chain complex assembly Biological Process

GO:0034605 cellular response to heat Biological Process

KEGG gene cross-reference

ath:AT5G51740

cal:CAALFM_C404550CA

sce:YKR087C

spo:2541915

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.906

Rank 1 · LXL04_021699 · OH-1004

Plastid0.060

Rank 2 · LXL04_021699 · OH-1004

Cytoplasm0.058

Rank 3 · LXL04_021699 · OH-1004

Nucleus0.053

Rank 4 · LXL04_021699 · OH-1004

Cell membrane0.030

Rank 5 · LXL04_021699 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01435.25Peptidase_M48255-411 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_021699	`PF01435.25`	Peptidase_M48	255	411	4.6e-32	112.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FLI5`	Arabidopsis thaliana	Mitochondrial metalloendopeptidase OMA1	58.652%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card