LXL04_021067 | RubberDandelionOmics

Gene overview

LXL04_021067

Reference: OH-1004 Chr: Chr04 Coordinates: 120551693-120554062 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

510 bp · LXL04_021067|LXL04_021067|OH1004|cDNA

ATGTCGGAGCTGCTAATAGCAATTTTGAGCTCCAGCAAGGACCGGCAGTTTTCATATGAGGTATTCTTAACAGGTGAGAAAGTAGGTCTTGGTATGGGTAAAACCAGAAAGGATACACAACAACAAGCTGCCAAAAATGCCCTTCATACTTTAGCTGCtgagttGTTACCAGAATCCACAAACACTGTATTATTATATTCACCGATTTATAACATTTTTTGTCATGTCTTGTTATACGTGTGTGTGGTGTATTTTCTAAT...

CDS

Download CDS FASTA

510 bp · LXL04_021067|LXL04_021067|OH1004|CDS

ATGTCGGAGCTGCTAATAGCAATTTTGAGCTCCAGCAAGGACCGGCAGTTTTCATATGAGGTATTCTTAACAGGTGAGAAAGTAGGTCTTGGTATGGGTAAAACCAGAAAGGATACACAACAACAAGCTGCCAAAAATGCCCTTCATACTTTAGCTGCTGAGTTGTTACCAGAATCCACAAACACTGTATTATTATATTCACCGATTTATAACATTTTTTGTCATGTCTTGTTATACGTGTGTGTGGTGTATTTTCTAAT...

Protein

Download Protein FASTA

169 aa · LXL04_021067|LXL04_021067|OH1004|PROTEIN

MSELLIAILSSSKDRQFSYEVFLTGEKVGLGMGKTRKDTQQQAAKNALHTLAAELLPESTNTVLLYSPIYNIFCHVLLYVCVVYFLICVIFVHMFNVRLMFLSIMSNIVTKSRSCQIVNCTTLCLPLSICVPPHCAAWLKSVTQRAKYSPTAFINLWSSWIIKKKIILA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_021067`
TK1151 ID	TkA03G335070
OH-1004 ID	LXL04_021067
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	56.100
Protein coverage (%)	TK1151 45.238 / OH-1004 29.586 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_021067

Location Chr04:120551693-120554062 (+)

Description Similar to CPL2: RNA polymerase II C-terminal domain phosphatase-like 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g01270`	Processively dephosphorylates 'Ser-5' but not 'Ser-2' of the heptad repeats YSPTSPS in the C-terminal domain of the largest RNA polymerase II subunit (RPB1).	Arabidopsis C-terminal domain phosphatase-like 1 and 2 are essential Ser-5-specific C-terminal domain phosphatases.2004 · DOI: 10.1073/pnas.0403174101 The Arabidopsis thaliana carboxyl-terminal domain phosphatase-like 2 regulates plant growth, stress and auxin responses.2008 · DOI: 10.1007/s11103-008-9348-y A protein complex regulates RNA processing of intronic heterochromatin-containing genes in Arabidopsis .2017 · DOI: 10.1073/pnas.1710683114 Coupling of H3K27me3 recognition with transcriptional repression through the BAH-PHD-CPL2 complex in Arabidopsis.2020 · DOI: 10.1038/s41467-020-20089-0

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021067 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0009733 response to auxin Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0010468 regulation of gene expression Biological Process

GO:0034244 negative regulation of transcription elongation by RNA polymerase II Biological Process

GO:0045814 negative regulation of gene expression, epigenetic Biological Process

GO:0048589 developmental growth Biological Process

GO:2000028 regulation of photoperiodism, flowering Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0003723 RNA binding Molecular Function

KEGG gene cross-reference

ath:AT5G01270

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.459

Rank 1 · LXL04_021067 · OH-1004

Nucleus0.365

Rank 2 · LXL04_021067 · OH-1004

Mitochondrion0.157

Rank 3 · LXL04_021067 · OH-1004

Endoplasmic reticulum0.092

Rank 4 · LXL04_021067 · OH-1004

Cell membrane0.083

Rank 5 · LXL04_021067 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q5YDB5`	Arabidopsis thaliana	RNA polymerase II C-terminal domain phosphatase-like 2	60.000%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card