LXL04_021034 | RubberDandelionOmics

Gene overview

LXL04_021034

Reference: OH-1004 Chr: Chr04 Coordinates: 119370334-119372269 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1137 bp · LXL04_021034|LXL04_021034|OH1004|cDNA

ATGGCATCGTCTGTTTTTTCGGAGTGGCGCCAAACGAAAACTAGAAACACACCAGATTTGGTATTCCCGCCATGGTTGGCGTCGATATCATCTTCCGCCATTCACAACAACAATCGCAGAAAGCAAACCCGttcttttctctctttctttctcgAAATGGATTTGTCGGAGATTGCAAGGAAGTTAGGGCTTAAGGAATCGAAGCAAGTCGTCCGTAAAGCCGCTGAACTCCGTCGCGTCTCCGATCTTCAATTCGATTC...

CDS

Download CDS FASTA

1137 bp · LXL04_021034|LXL04_021034|OH1004|CDS

ATGGCATCGTCTGTTTTTTCGGAGTGGCGCCAAACGAAAACTAGAAACACACCAGATTTGGTATTCCCGCCATGGTTGGCGTCGATATCATCTTCCGCCATTCACAACAACAATCGCAGAAAGCAAACCCGTTCTTTTCTCTCTTTCTTTCTCGAAATGGATTTGTCGGAGATTGCAAGGAAGTTAGGGCTTAAGGAATCGAAGCAAGTCGTCCGTAAAGCCGCTGAACTCCGTCGCGTCTCCGATCTTCAATTCGATTC...

Protein

Download Protein FASTA

378 aa · LXL04_021034|LXL04_021034|OH1004|PROTEIN

MASSVFSEWRQTKTRNTPDLVFPPWLASISSSAIHNNNRRKQTRSFLSFFLEMDLSEIARKLGLKESKQVVRKAAELRRVSDLQFDSSSAGIGEICKAVICLEIAANMKQVLFDRHSAIKLSGMSEKAYIRSFNVMQNGIGVKYVHIFRLPYYHRSFYSTSTSESNRFVLNQELNRYFVITRRNRLDIRELAIQFGCVRLIPLVQKGLSLYRERFMASLPPSRRASTDCSRPVFTAIGFYLCAKKHKLKVDKTKLIELSG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_021034`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_021034

Location Chr04:119370334-119372269 (+)

Description Similar to ORC6: Origin of replication complex subunit 6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g26840`	Component of the origin recognition complex (ORC) that binds origins of replication.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2YNY4`	Component of the origin recognition complex (ORC) that binds origins of replication.	No verified direct reference in this release
`Os07g0628600`	Component of the origin recognition complex (ORC) that binds origins of replication.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021034 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006260 DNA replication Biological Process

GO:0006261 DNA-templated DNA replication Biological Process

GO:0006270 DNA replication initiation Biological Process

GO:0009555 pollen development Biological Process

GO:0000808 origin recognition complex Cellular Component

GO:0001650 fibrillar center Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005664 nuclear origin of replication recognition complex Cellular Component

GO:0003677 DNA binding Molecular Function

KEGG gene cross-reference

ath:AT1G26840

bta:515476

dosa:Os07g0628600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.957

Rank 1 · LXL04_021034 · OH-1004

Cytoplasm0.098

Rank 2 · LXL04_021034 · OH-1004

Cell membrane0.021

Rank 3 · LXL04_021034 · OH-1004

Mitochondrion0.012

Rank 4 · LXL04_021034 · OH-1004

Endoplasmic reticulum0.012

Rank 5 · LXL04_021034 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05460.19ORC655-143 aa

PF21913.2ORC6_2nd186-276 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_021034	`PF05460.19`	ORC6	55	143	1.5e-24	86.9
LXL04_021034	`PF21913.2`	ORC6_2nd	186	276	2e-33	115.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZVH3`	Arabidopsis thaliana	Origin of replication complex subunit 6	56.037%	Swiss-Prot	strong database homology
`A2YNY4`	Oryza sativa subsp. indica	Origin of replication complex subunit 6	55.856%	Swiss-Prot	strong database homology
`Q8GSL4`	Oryza sativa subsp. japonica	Origin of replication complex subunit 6	55.120%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card