LXL04_020354 | RubberDandelionOmics

Gene overview

LXL04_020354

Reference: OH-1004 Chr: Chr04 Coordinates: 69841074-69842693 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

753 bp · LXL04_020354|LXL04_020354|OH1004|cDNA

ATGCCTGAGGTTAAAGAAATCATTGTAGTTTGTGATCCATCTTACCGCGACATATTTGAAGGTGCTGGAGAGAAAATCAATGTTGGCCTGAAATTTGCATTGCCTGGAAAAGAAAGACAAGATCCTGTATACAGTGGACTTCAGGCAATTGATTTGAATTCTGAACTTGCTTGCATCCATGATTCTGCAAGACCTTTGGTAACTTGTAGTGATGTACAAAAGGTTCTTAATGATGGTTTGCGTGTTGGAGCTTCAGTACT...

CDS

Download CDS FASTA

753 bp · LXL04_020354|LXL04_020354|OH1004|CDS

ATGCCTGAGGTTAAAGAAATCATTGTAGTTTGTGATCCATCTTACCGCGACATATTTGAAGGTGCTGGAGAGAAAATCAATGTTGGCCTGAAATTTGCATTGCCTGGAAAAGAAAGACAAGATCCTGTATACAGTGGACTTCAGGCAATTGATTTGAATTCTGAACTTGCTTGCATCCATGATTCTGCAAGACCTTTGGTAACTTGTAGTGATGTACAAAAGGTTCTTAATGATGGTTTGCGTGTTGGAGCTTCAGTACT...

Protein

Download Protein FASTA

250 aa · LXL04_020354|LXL04_020354|OH1004|PROTEIN

MPEVKEIIVVCDPSYRDIFEGAGEKINVGLKFALPGKERQDPVYSGLQAIDLNSELACIHDSARPLVTCSDVQKVLNDGLRVGASVLGVPAKATIKEANSESFVVKTLDRKNTLGNVNTNNRFGVLIRLKGMLFDFLGLYWSNKVILQPFFSMIGRQGQFRKAAYVCFWGRVLLISLLWWQQQMIRYASSYSHLEYSRYAVKFRFWGRGKMSKRNRKKIAILDQKCKGASCNVRLLLQPLDIVDLNHSSA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_020354`
TK1151 ID	TkA03G299440
OH-1004 ID	LXL04_020354
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	93.300
Protein coverage (%)	TK1151 100.000 / OH-1004 47.600 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_020354

Location Chr04:69841074-69842693 (-)

Description Similar to ISPD: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g02500`	Enzyme of the plastid non-mevalonate pathway for isoprenoid biosynthesis that catalyzes the formation of 4-diphosphocytidyl-2-C-methyl-D-erythritol from CTP and 2-C-methyl-D-erythritol 4-phosphate (MEP).	Biosynthesis of terpenoids: 4-diphosphocytidyl-2C-methyl-D-erythritol synthase of Arabidopsis thaliana.2000 · DOI: 10.1073/pnas.97.12.6451 Antisense and chemical suppression of the nonmevalonate pathway affects ent-kaurene biosynthesis in Arabidopsis.2002 · DOI: 10.1007/s00425-002-0762-0 Chloroplast localization of methylerythritol 4-phosphate pathway enzymes and regulation of mitochondrial genes in ispD and ispE albino mutants in Arabidopsis.2008 · DOI: 10.1007/s11103-008-9297-5

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0887000`	Enzyme of the plastid non-mevalonate pathway for isoprenoid biosynthesis that catalyzes the formation of 4-diphosphocytidyl-2-C-methyl-D-erythritol from CTP and 2-C-methyl-D-erythritol 4-phosphate (MEP).	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_020354 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0019288 isopentenyl diphosphate biosynthetic process, methylerythritol 4-phosphate pathway Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0050518 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT2G02500

cmu:TC_0747

cpa:CP_0169

cpj:yacM

cpn:CPn_0579

cpt:CpB0603

dosa:Os01g0887000

pcu:PC_RS01595

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.423

Rank 1 · LXL04_020354 · OH-1004

Nucleus0.273

Rank 2 · LXL04_020354 · OH-1004

Mitochondrion0.210

Rank 3 · LXL04_020354 · OH-1004

Endoplasmic reticulum0.083

Rank 4 · LXL04_020354 · OH-1004

Cell membrane0.079

Rank 5 · LXL04_020354 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01128.26IspD2-124 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_020354	`PF01128.26`	IspD	2	124	8.7e-16	59.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P69834`	Arabidopsis thaliana	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, chloroplastic	75.893%	Swiss-Prot	weak database homology
`Q5N8G1`	Oryza sativa subsp. japonica	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, chloroplastic	69.608%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card