LXL04_020308 | RubberDandelionOmics

Gene overview

LXL04_020308

Reference: OH-1004 Chr: Chr04 Coordinates: 65046659-65058249 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3039 bp · LXL04_020308|LXL04_020308|OH1004|cDNA

ATGGATCATGAGACACAGGAATATGGCAGATACAACATTTCAAACTCATCTGCCAGTAGCGATGTCTTTGAGCCTACATCAGTAAATGATGCCAAGATGCGAACATCGGTGATAGAGTGGCTGAATAGCAGTCTTCCCACTTTGAATCTTTCGGTGAACGCTTCAGATGAGGAGTTGAGAGCTTTTTTGGCCGATGGTACTATTCTGTGTCGACTTATGAACAAACATAGACCAGTTTCTATTATTGAGTATGGTAATCC...

CDS

Download CDS FASTA

3039 bp · LXL04_020308|LXL04_020308|OH1004|CDS

ATGGATCATGAGACACAGGAATATGGCAGATACAACATTTCAAACTCATCTGCCAGTAGCGATGTCTTTGAGCCTACATCAGTAAATGATGCCAAGATGCGAACATCGGTGATAGAGTGGCTGAATAGCAGTCTTCCCACTTTGAATCTTTCGGTGAACGCTTCAGATGAGGAGTTGAGAGCTTTTTTGGCCGATGGTACTATTCTGTGTCGACTTATGAACAAACATAGACCAGTTTCTATTATTGAGTATGGTAATCC...

Protein

Download Protein FASTA

1012 aa · LXL04_020308|LXL04_020308|OH1004|PROTEIN

MDHETQEYGRYNISNSSASSDVFEPTSVNDAKMRTSVIEWLNSSLPTLNLSVNASDEELRAFLADGTILCRLMNKHRPVSIIEYGNPQHSSEAQSENVKKFLEAMDDMNLPHFNISELEKGSMKIVMECLLTLKAHFMTKVAVVGSPTATSPKSWASESVRWKHADERTETSDSYQEDVSPRKFHRALRSPMMSEATTALMHHAGHRFHEVFQMKHGGYSDLPAAKISELMKSNSLDIAPTQSLLSMVNGILDESISRKS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_020308`
TK1151 ID	TkA05G164390
OH-1004 ID	LXL04_020308
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	92.300
Protein coverage (%)	TK1151 99.498 / OH-1004 55.138 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_020308

Location Chr04:65046659-65058249 (+)

Description Similar to KIN14C: Kinesin-like protein KIN-14C

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g73860`	Kinesin-like protein KIN-14P.	No verified direct reference in this release
`At1g63640`	Kinesin-like protein KIN-14J.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0744000`	Kinesin-like protein KIN-14C.	No verified direct reference in this release
`Os05g0521300`	Kinesin-like protein KIN-14K.	No verified direct reference in this release
`UniProt: Q0E2L3`	Kinesin-like protein KIN-14D.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_020308 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007017 microtubule-based process Biological Process

GO:0007018 microtubule-based movement Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005874 microtubule Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0015630 microtubule cytoskeleton Cellular Component

GO:0003777 microtubule motor activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0008017 microtubule binding Molecular Function

KEGG gene cross-reference

ath:AT1G63640

ath:AT1G73860

dosa:Os01g0744000

dosa:Os02g0229500

dosa:Os02g0229600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.701

Rank 1 · LXL04_020308 · OH-1004

Nucleus0.203

Rank 2 · LXL04_020308 · OH-1004

Cell membrane0.177

Rank 3 · LXL04_020308 · OH-1004

Golgi apparatus0.077

Rank 4 · LXL04_020308 · OH-1004

Lysosome / Vacuole0.043

Rank 5 · LXL04_020308 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00307.37CH34-138 aa

PF16796.12Microtub_bd519-656 aa

PF00225.30Kinesin539-657 aa

PF00225.30Kinesin656-819 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_020308	`PF00307.37`	CH	34	138	4.8e-12	46.7
LXL04_020308	`PF16796.12`	Microtub_bd	519	656	9e-38	130.3
LXL04_020308	`PF00225.30`	Kinesin	539	657	9.2e-87	291.8
LXL04_020308	`PF00225.30`	Kinesin	656	819	9.2e-87	291.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q0WN69`	Arabidopsis thaliana	Kinesin-like protein KIN-14P	50.059%	Swiss-Prot	moderate database homology
`B3H6Z8`	Arabidopsis thaliana	Kinesin-like protein KIN-14J	46.696%	Swiss-Prot	moderate database homology
`Q5JKW1`	Oryza sativa subsp. japonica	Kinesin-like protein KIN-14C	49.658%	Swiss-Prot	moderate database homology
`B9FL70`	Oryza sativa subsp. japonica	Kinesin-like protein KIN-14K	48.678%	Swiss-Prot	moderate database homology
`Q0E2L3`	Oryza sativa subsp. japonica	Kinesin-like protein KIN-14D	47.403%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card