LXL04_019143 | RubberDandelionOmics

Gene overview

LXL04_019143

Reference: OH-1004 Chr: Chr04 Coordinates: 24539183-24554851 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

5217 bp · LXL04_019143|LXL04_019143|OH1004|cDNA

ATGTTCCTCCTCGTCAATACCAATGAAGTCGACAAGAAGTATTCCTTTACTTTTGTTATTGTTCTGCCTAGCAATCACACAGTCTACATCTCAATCAACCACCACAAACACCACTACCGCCGCAAAGCCCGGCTGCCAAAAGCAATGTGGAAACGTAACCATTCCATATCCCTTCGGTATCGGTCCAACTGTTTTCTAAGCCGGTGGTTTGAAATCACCTGCAACACTACTTTTAATCCTTCCAAACCCTTCATCGACGG...

CDS

Download CDS FASTA

5217 bp · LXL04_019143|LXL04_019143|OH1004|CDS

ATGTTCCTCCTCGTCAATACCAATGAAGTCGACAAGAAGTATTCCTTTACTTTTGTTATTGTTCTGCCTAGCAATCACACAGTCTACATCTCAATCAACCACCACAAACACCACTACCGCCGCAAAGCCCGGCTGCCAAAAGCAATGTGGAAACGTAACCATTCCATATCCCTTCGGTATCGGTCCAACTGTTTTCTAAGCCGGTGGTTTGAAATCACCTGCAACACTACTTTTAATCCTTCCAAACCCTTCATCGACGG...

Protein

Download Protein FASTA

1738 aa · LXL04_019143|LXL04_019143|OH1004|PROTEIN

MFLLVNTNEVDKKYSFTFVIVLPSNHTVYISINHHKHHYRRKARLPKAMWKRNHSISLRYRSNCFLSRWFEITCNTTFNPSKPFIDGLSILEITDSTFRVATKVASKCYDQFGNVTEDDPVTTNIGWTSPFTFSQRNQFTLIGCDDIAVFQGPLQANFTSGCLALCTQPEQVSNGSCDGVGCCQISIPKGIKYYAISLASSVTSTNHMNIWSFDPCTYSFMSERDRFPFHGVSDFMDPNFKTRTKASVPMLVDWVIGNLS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_019143`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_019143

Location Chr04:24539183-24554851 (-)

Description Similar to WAK2: Wall-associated receptor kinase 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g21270`	Serine/threonine-protein kinase that may function as a signaling receptor of extracellular matrix component.	No verified direct reference in this release
`At1g21250`	Serine/threonine-protein kinase that may function as a signaling receptor of extracellular matrix component.	Oxygen-evolving enhancer protein 2 is phosphorylated by glycine-rich protein 3/wall-associated kinase 1 in Arabidopsis.2003 · DOI: 10.1016/s0006-291x(03)00851-9 Aluminum-induced gene expression and protein localization of a cell wall-associated receptor kinase in Arabidopsis.2003 · DOI: 10.1104/pp.103.022129
`At1g21240`	Serine/threonine-protein kinase that may function as a signaling receptor of extracellular matrix component.	No verified direct reference in this release
`At1g21230`	Serine/threonine-protein kinase that may function as a signaling receptor of extracellular matrix component.	No verified direct reference in this release
`At1g21210`	Serine/threonine-protein kinase that may function as a signaling receptor of extracellular matrix component.	Antisense expression of a cell wall-associated protein kinase, WAK4, inhibits cell elongation and alters morphology.2001 · DOI: 10.1105/tpc.13.6.1317

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019143 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007166 cell surface receptor signaling pathway Biological Process

GO:0009311 oligosaccharide metabolic process Biological Process

GO:0009615 response to virus Biological Process

GO:0009751 response to salicylic acid Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0009992 intracellular water homeostasis Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT1G21240

ath:AT1G21250

ath:AT1G21270

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.840

Rank 1 · LXL04_019143 · OH-1004

Cytoplasm0.086

Rank 2 · LXL04_019143 · OH-1004

Endoplasmic reticulum0.078

Rank 3 · LXL04_019143 · OH-1004

Nucleus0.053

Rank 4 · LXL04_019143 · OH-1004

Lysosome / Vacuole0.030

Rank 5 · LXL04_019143 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07645.22EGF_CA308-340 aa

PF12947.14EGF_3323-345 aa

PF00069.32Pkinase436-701 aa

PF07714.24PK_Tyr_Ser-Thr438-704 aa

PF13947.12GUB_WAK_bind1018-1068 aa

PF07645.22EGF_CA1279-1311 aa

PF14670.13FXa_inhibition1283-1321 aa

PF12947.14EGF_31294-1316 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_019143	`PF07645.22`	EGF_CA	308	340	2.7e-17	63.4
LXL04_019143	`PF12947.14`	EGF_3	323	345	1e-11	45.5
LXL04_019143	`PF00069.32`	Pkinase	436	701	2.9e-100	335.7
LXL04_019143	`PF07714.24`	PK_Tyr_Ser-Thr	438	704	1.1e-95	320.5
LXL04_019143	`PF13947.12`	GUB_WAK_bind	1018	1068	1.2e-07	32.7
LXL04_019143	`PF07645.22`	EGF_CA	1279	1311	2.7e-17	63.4
LXL04_019143	`PF14670.13`	FXa_inhibition	1283	1321	1.1e-06	29.3
LXL04_019143	`PF12947.14`	EGF_3	1294	1316	1e-11	45.5
LXL04_019143	`PF00069.32`	Pkinase	1405	1673	2.9e-100	335.7
LXL04_019143	`PF07714.24`	PK_Tyr_Ser-Thr	1409	1675	1.1e-95	320.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LMP1`	Arabidopsis thaliana	Wall-associated receptor kinase 2	43.375%	Swiss-Prot	weak database homology
`Q39191`	Arabidopsis thaliana	Wall-associated receptor kinase 1	41.398%	Swiss-Prot	weak database homology
`Q9LMN8`	Arabidopsis thaliana	Wall-associated receptor kinase 3	41.176%	Swiss-Prot	weak database homology
`Q9LMN7`	Arabidopsis thaliana	Wall-associated receptor kinase 5	42.700%	Swiss-Prot	weak database homology
`Q9LMN6`	Arabidopsis thaliana	Wall-associated receptor kinase 4	41.607%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card