LXL04_016682 | RubberDandelionOmics

Gene overview

LXL04_016682

Reference: OH-1004 Chr: Chr03 Coordinates: 130748414-130749403 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

580 bp · LXL04_016682|LXL04_016682|OH1004|cDNA

cccGTAAGACCATTAAACTTAAAGTTTACAATTCTAAAATACCATTATCGGTTAAAACTAACAGATTTATCAGTTAAATGCCAATGTATAATAAACTATAGCCAAGTGGACATATCCACATGGACATCCCACACACATCACCTCCCACTTCTCCAGCTATGTTCCTCCCACGCAGACAAACCACAGAGTCACCAAGCTCACTGATCTCGACATGTCCGTCAACAAACTCACCGGGAAACTACCGAAACACGTTTGCCGTC...

CDS

Download CDS FASTA

369 bp · LXL04_016682|LXL04_016682|OH1004|CDS

ATGTCCGTCAACAAACTCACCGGGAAACTACCGAAACACGTTTGCCGTCTTCCAAAGCTGCAAGTTCTTCCGCTTTACAATAACAGTCTCACTGGAGATTTCGGTTCTGTTGGAGAAGTCGGAGACTTTAACCATGTTGTTGCCGCTTTTTCACATGAGCAAACTGTCGGTGTGAAATTCAAGAACGTAATGTGTATCGATTTGAGTTACTTTCTAGAAGGGAACATACCAGAAGGAATTCCTGGTCCCCCTTCCGTTTC...

Protein

Download Protein FASTA

122 aa · LXL04_016682|LXL04_016682|OH1004|PROTEIN

MSVNKLTGKLPKHVCRLPKLQVLPLYNNSLTGDFGSVGEVGDFNHVVAAFSHEQTVGVKFKNVMCIDLSYFLEGNIPEGIPGPPSVSIIDLSYNFLNGSITKSIGILSSASPNSMCSSPSPD

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_016682`
TK1151 ID	TkA03G525450
OH-1004 ID	LXL04_016682
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	78.800
Protein coverage (%)	TK1151 47.305 / OH-1004 65.574 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_016682

Location Chr03:130748414-130749403 (+)

Description Similar to BAM1: Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g65700`	LRR-rich receptor-like kinase (LRR-RLK) that, similarly to CLV1 and BAM3, participates in the detection of the CLAVATA-family peptides (e.g. CLE25, CLE26 and CLE45), and to the regulation of the triggered signaling required for protophloem differentiation and meristems maintenance through the phosphorylation of CIK proteins (CIKs) and of PBL34, PBL35 and PBL36.	No verified direct reference in this release
`At3g49670`	LRR-rich receptor-like kinase (LRR-RLK) implicated in the detection of the CLAVATA-family peptides (CLEs), and to the regulation of the triggered signaling required for protophloem differentiation and meristems maintenance through the phosphorylation of CIK proteins (CIKs) and, probably, of PBL34, PBL35 and PBL36.	No verified direct reference in this release
`At5g49660`	Receptor kinase involved in the perception of C-terminally encoded plant signaling peptide (CEP) and subsequent regulation of root and shoot development.	XYLEM INTERMIXED WITH PHLOEM1, a leucine-rich repeat receptor-like kinase required for stem growth and vascular development in Arabidopsis thaliana.2012 · DOI: 10.1007/s00425-011-1489-6 CEP5 and XIP1/CEPR1 regulate lateral root initiation in Arabidopsis.2016 · DOI: 10.1093/jxb/erw231
`At5g20480`	Constitutes the pattern-recognition receptor (PPR) that determines the specific perception of elongation factor Tu (EF-Tu), a potent elicitor of the defense response to pathogen-associated molecular patterns (PAMPs); phosphorylates BIK1 upon elicitation to regulate immune responses such as defense hormone expression (e.g. jasmonic acid (JA) and salicylic acid (SA)).	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0130100`	Receptor kinase involved in salt drought stress responses.	Receptor-like kinase OsSIK1 improves drought and salt stress tolerance in rice (Oryza sativa) plants.2010 · DOI: 10.1111/j.1365-313x.2010.04146.x

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016682 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002237 response to molecule of bacterial origin Biological Process

GO:0002764 immune response-regulating signaling pathway Biological Process

GO:0009553 embryo sac development Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0009755 hormone-mediated signaling pathway Biological Process

GO:0009934 regulation of meristem structural organization Biological Process

GO:0010051 xylem and phloem pattern formation Biological Process

GO:0010075 regulation of meristem growth Biological Process

GO:0010103 stomatal complex morphogenesis Biological Process

GO:0010311 lateral root formation Biological Process

GO:0016045 detection of bacterium Biological Process

GO:0030154 cell differentiation Biological Process

KEGG gene cross-reference

ath:AT3G49670

ath:AT5G20480

ath:AT5G49660

ath:AT5G65700

dosa:Os06g0130100

osa:4340000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.310

Rank 1 · LXL04_016682 · OH-1004

Cytoplasm0.177

Rank 2 · LXL04_016682 · OH-1004

Extracellular0.176

Rank 3 · LXL04_016682 · OH-1004

Nucleus0.159

Rank 4 · LXL04_016682 · OH-1004

Endoplasmic reticulum0.152

Rank 5 · LXL04_016682 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O49545`	Arabidopsis thaliana	Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM1	37.273%	Swiss-Prot	moderate database homology
`Q9M2Z1`	Arabidopsis thaliana	Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM2	35.455%	Swiss-Prot	moderate database homology
`Q9FGL5`	Arabidopsis thaliana	Receptor protein-tyrosine kinase CEPR1	34.286%	Swiss-Prot	moderate database homology
`C0LGT6`	Arabidopsis thaliana	LRR receptor-like serine/threonine-protein kinase EFR	31.579%	Swiss-Prot	moderate database homology
`Q658G7`	Oryza sativa subsp. japonica	LRR receptor-like serine/threonine-protein kinase SIK1	33.333%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card