LXL04_015942 | RubberDandelionOmics

Gene overview

LXL04_015942

Reference: OH-1004 Chr: Chr03 Coordinates: 99458780-99459319 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

468 bp · LXL04_015942|LXL04_015942|OH1004|cDNA

ATGGGAGTTTCAGGAACATTGGAGTACATATCAGATTTAATAAGCATCGGCCATAAAAACAAAAGCAAGAAAAGGCAGCAACTACGAACAGTAGATCTCAAGGTCCGAATGGACTGCGATGGTTGTGAACTAAAAGTCAAGAAAGCCCTCTCTTCTCTTTCTGGAGTGAAGAAGGTTGAAATAAACAGGAAACAACAGAAGGTGACAGTGAGTGGGTATGTAGAACCAAACAAGGTGCTGAAGAAGGCCAAGTCAACGGG...

CDS

Download CDS FASTA

468 bp · LXL04_015942|LXL04_015942|OH1004|CDS

ATGGGAGTTTCAGGAACATTGGAGTACATATCAGATTTAATAAGCATCGGCCATAAAAACAAAAGCAAGAAAAGGCAGCAACTACGAACAGTAGATCTCAAGGTCCGAATGGACTGCGATGGTTGTGAACTAAAAGTCAAGAAAGCCCTCTCTTCTCTTTCTGGAGTGAAGAAGGTTGAAATAAACAGGAAACAACAGAAGGTGACAGTGAGTGGGTATGTAGAACCAAACAAGGTGCTGAAGAAGGCCAAGTCAACGGG...

Protein

Download Protein FASTA

155 aa · LXL04_015942|LXL04_015942|OH1004|PROTEIN

MGVSGTLEYISDLISIGHKNKSKKRQQLRTVDLKVRMDCDGCELKVKKALSSLSGVKKVEINRKQQKVTVSGYVEPNKVLKKAKSTGKKSEIWPYVPYNLVAQPYAAQVYDKKAPPGYVRRVETTASVGVTRYEDPSYSYVTLFSDDNPNACSVM

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_015942`
TK1151 ID	TkA01G045850
OH-1004 ID	LXL04_015942
Relationship / confidence	Rbh High Identity Coverage Local Synteny Minor Chr Pair / Probable
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_015942

Location Chr03:99458780-99459319 (+)

Description Similar to HIPP23: Heavy metal-associated isoprenylated plant protein 23

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g39700`	Heavy-metal-binding protein.	No verified direct reference in this release
`At4g08570`	Heavy-metal-binding protein.	No verified direct reference in this release
`At1g71050`	Heavy-metal-binding protein.	Metallochaperone-like genes in Arabidopsis thaliana.2010 · DOI: 10.1039/c003484c
`At4g38580`	Heavy-metal-binding protein.	Metallochaperone-like genes in Arabidopsis thaliana.2010 · DOI: 10.1039/c003484c
`At1g22990`	Heavy-metal-binding protein.	Metallochaperone-like genes in Arabidopsis thaliana.2010 · DOI: 10.1039/c003484c

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015942 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0010286 heat acclimation Biological Process

GO:0071585 detoxification of cadmium ion Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0016020 membrane Cellular Component

GO:0031965 nuclear membrane Cellular Component

GO:0005507 copper ion binding Molecular Function

GO:0032791 lead ion binding Molecular Function

GO:0046870 cadmium ion binding Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G22990

ath:AT1G71050

ath:AT4G08570

ath:AT4G38580

ath:AT4G39700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.554

Rank 1 · LXL04_015942 · OH-1004

Nucleus0.314

Rank 2 · LXL04_015942 · OH-1004

Cytoplasm0.293

Rank 3 · LXL04_015942 · OH-1004

Endoplasmic reticulum0.054

Rank 4 · LXL04_015942 · OH-1004

Mitochondrion0.032

Rank 5 · LXL04_015942 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00403.33HMA34-89 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_015942	`PF00403.33`	HMA	34	89	1.5e-14	54.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O65657`	Arabidopsis thaliana	Heavy metal-associated isoprenylated plant protein 23	69.375%	Swiss-Prot	strong database homology
`O81464`	Arabidopsis thaliana	Heavy metal-associated isoprenylated plant protein 24	57.692%	Swiss-Prot	strong database homology
`Q9C9A3`	Arabidopsis thaliana	Heavy metal-associated isoprenylated plant protein 20	58.333%	Swiss-Prot	strong database homology
`Q9SZN7`	Arabidopsis thaliana	Heavy metal-associated isoprenylated plant protein 26	51.974%	Swiss-Prot	strong database homology
`Q93VP2`	Arabidopsis thaliana	Heavy metal-associated isoprenylated plant protein 22	56.051%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card