LXL04_014625 | RubberDandelionOmics

Gene overview

LXL04_014625

Reference: OH-1004 Chr: Chr03 Coordinates: 54097446-54100270 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2232 bp · LXL04_014625|LXL04_014625|OH1004|cDNA

ATGTATGATGAGATTGAGAAAGAGTGCCACCCTCTGTTACAAGGTGGGAGAGACGAAAAGTACGTAAACGGAGGCTTTTCTTCATCAGGAATGGCGACTCTGAGCAGTATATGTGACGTCATCCTGCAACCACTCCCTTTAAATTCTCTCGATGATCATGGCAACAAAGATGACGAAACCATCCGCTCGTTCTCCTCTGTTTCTGGTTCTCAATACCCAATACCTAATAAGCTAGTTCATCTTCTGGTAACGAGGGCGTT...

CDS

Download CDS FASTA

2232 bp · LXL04_014625|LXL04_014625|OH1004|CDS

ATGTATGATGAGATTGAGAAAGAGTGCCACCCTCTGTTACAAGGTGGGAGAGACGAAAAGTACGTAAACGGAGGCTTTTCTTCATCAGGAATGGCGACTCTGAGCAGTATATGTGACGTCATCCTGCAACCACTCCCTTTAAATTCTCTCGATGATCATGGCAACAAAGATGACGAAACCATCCGCTCGTTCTCCTCTGTTTCTGGTTCTCAATACCCAATACCTAATAAGCTAGTTCATCTTCTGGTAACGAGGGCGTT...

Protein

Download Protein FASTA

743 aa · LXL04_014625|LXL04_014625|OH1004|PROTEIN

MYDEIEKECHPLLQGGRDEKYVNGGFSSSGMATLSSICDVILQPLPLNSLDDHGNKDDETIRSFSSVSGSQYPIPNKLVHLLVTRAFFEAIMVVKLVVIILSTRLGTLLLSGTLCISHKWPYVHKFSEIPLHKREKVVQKWMNHRFLTPIRLGFVFIKTLCLLVFFSQADKKAENPAWEAIGYHVDLKEEEPKKDQNERPLQKGMVEIMKETDQTLVHSLIQKGLDVTDNLKENICKIKCDVVIVGSGCGGGVAAAILAK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_014625`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_014625

Location Chr03:54097446-54100270 (-)

Description Similar to FAO1: Long-chain-alcohol oxidase FAO1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g23410`	Long-chain fatty alcohol oxidase involved in the omega- oxidation pathway of lipid degradation.	Functional identification of AtFao3, a membrane bound long chain alcohol oxidase in Arabidopsis thaliana.2004 · DOI: 10.1016/j.febslet.2004.07.086 Cloning and characterization of long-chain fatty alcohol oxidase LjFAO1 in lotus japonicus.2008 · DOI: 10.1021/bp0703533
`At4g28570`	Long-chain fatty alcohol oxidase involved in the omega-oxidation pathway of lipid degradation.	No verified direct reference in this release
`At1g03990`	Long-chain fatty alcohol oxidase involved in the omega-oxidation pathway of lipid degradation.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014625 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006066 alcohol metabolic process Biological Process

GO:0009409 response to cold Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0016020 membrane Cellular Component

GO:0046577 long-chain-alcohol oxidase activity Molecular Function

GO:0050660 flavin adenine dinucleotide binding Molecular Function

KEGG gene cross-reference

ag:CAP15762

ath:AT1G03990

ath:AT3G23410

ath:AT4G28570

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.456

Rank 1 · LXL04_014625 · OH-1004

Peroxisome0.289

Rank 2 · LXL04_014625 · OH-1004

Cytoplasm0.122

Rank 3 · LXL04_014625 · OH-1004

Endoplasmic reticulum0.081

Rank 4 · LXL04_014625 · OH-1004

Cell membrane0.055

Rank 5 · LXL04_014625 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00890.31FAD_binding_2241-274 aa

PF13450.13NAD_binding_8244-273 aa

PF00732.26GMC_oxred_N288-508 aa

PF05199.20GMC_oxred_C599-730 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_014625	`PF00890.31`	FAD_binding_2	241	274	8.7e-06	25.9
LXL04_014625	`PF13450.13`	NAD_binding_8	244	273	1e-05	26.4
LXL04_014625	`PF00732.26`	GMC_oxred_N	288	508	9.3e-77	258.4
LXL04_014625	`PF05199.20`	GMC_oxred_C	599	730	3.6e-23	83.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LW56`	Arabidopsis thaliana	Long-chain-alcohol oxidase FAO3	59.116%	Swiss-Prot	strong database homology
`Q94BP3`	Arabidopsis thaliana	Long-chain-alcohol oxidase FAO4B	55.196%	Swiss-Prot	strong database homology
`Q9ZWB9`	Arabidopsis thaliana	Long-chain-alcohol oxidase FAO1	52.477%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card