LXL04_013957 | RubberDandelionOmics

Gene overview

LXL04_013957

Reference: OH-1004 Chr: Chr03 Coordinates: 39086048-39087658 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

816 bp · LXL04_013957|LXL04_013957|OH1004|cDNA

ATGTTGATACCGTGGATGGCGAGCCCGAGGAAGCACAAGATCAGCTTCATGGTCACTGAAGCTGACGCGAGTTCAAGGCGAGCAAGGGTATTCTTTGCTCACTATCCCAACTCCATCTCCTCCTACCCATCTTCTACGGAGTGGAGATCTGCTAGAGCAACATACTATGCACCAGCTGACCCGCGGGACGCCATCGGCGGCGCATGTGGTTACGGTGACGTTGAGAAGGCGGGGTATGGGAAGGCGACAGCGGGGCTCAG...

CDS

Download CDS FASTA

816 bp · LXL04_013957|LXL04_013957|OH1004|CDS

ATGTTGATACCGTGGATGGCGAGCCCGAGGAAGCACAAGATCAGCTTCATGGTCACTGAAGCTGACGCGAGTTCAAGGCGAGCAAGGGTATTCTTTGCTCACTATCCCAACTCCATCTCCTCCTACCCATCTTCTACGGAGTGGAGATCTGCTAGAGCAACATACTATGCACCAGCTGACCCGCGGGACGCCATCGGCGGCGCATGTGGTTACGGTGACGTTGAGAAGGCGGGGTATGGGAAGGCGACAGCGGGGCTCAG...

Protein

Download Protein FASTA

271 aa · LXL04_013957|LXL04_013957|OH1004|PROTEIN

MLIPWMASPRKHKISFMVTEADASSRRARVFFAHYPNSISSYPSSTEWRSARATYYAPADPRDAIGGACGYGDVEKAGYGKATAGLSTVLFQKGQICGACFEVRCVEDLQWCIPGTSIIVTATNFCAPNYGFPADGGGKCNPPNPHFVLPIEIFEKIAIWKASNMPIQYRRIKCRKEGGIRFTIDGAGIFLSVLISNVAGAGDLAAVKIKGSRTGWLPMNRNWGQNWHINADIKNQPLSFEVTSSDGLTVTSYNVAPKDW...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_013957`
TK1151 ID	TkA06G105830
OH-1004 ID	LXL04_013957
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	87.200
Protein coverage (%)	TK1151 92.045 / OH-1004 88.192 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_013957

Location Chr03:39086048-39087658 (-)

Description Similar to EXPA13: Expansin-A13

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g03220`	Causes loosening and extension of plant cell walls by disrupting non-covalent bonding between cellulose microfibrils and matrix glucans.	No verified direct reference in this release
`At3g55500`	Causes loosening and extension of plant cell walls by disrupting non-covalent bonding between cellulose microfibrils and matrix glucans.	No verified direct reference in this release
`At5g56320`	Causes loosening and extension of plant cell walls by disrupting non-covalent bonding between cellulose microfibrils and matrix glucans.	LBD18 acts as a transcriptional activator that directly binds to the EXPANSIN14 promoter in promoting lateral root emergence of Arabidopsis.2013 · DOI: 10.1111/tpj.12013

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0583500`	May cause loosening and extension of plant cell walls by disrupting non-covalent bonding between cellulose microfibrils and matrix glucans.	No verified direct reference in this release
`Os01g0823100`	May cause loosening and extension of plant cell walls by disrupting non-covalent bonding between cellulose microfibrils and matrix glucans.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013957 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006949 syncytium formation Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0009828 plant-type cell wall loosening Biological Process

GO:0010311 lateral root formation Biological Process

GO:0005576 extracellular region Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT3G03220

ath:AT3G55500

ath:AT5G56320

dosa:Os01g0823100

dosa:Os04g0583500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.480

Rank 1 · LXL04_013957 · OH-1004

Lysosome / Vacuole0.146

Rank 2 · LXL04_013957 · OH-1004

Cytoplasm0.108

Rank 3 · LXL04_013957 · OH-1004

Plastid0.089

Rank 4 · LXL04_013957 · OH-1004

Endoplasmic reticulum0.065

Rank 5 · LXL04_013957 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF29515.1Expansin_N65-158 aa

PF03330.25DPBB_184-169 aa

PF01357.28Expansin_C180-257 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_013957	`PF29515.1`	Expansin_N	65	158	2.6e-09	38.0
LXL04_013957	`PF03330.25`	DPBB_1	84	169	1.8e-15	57.6
LXL04_013957	`PF01357.28`	Expansin_C	180	257	1.3e-28	99.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M9P0`	Arabidopsis thaliana	Expansin-A13	80.444%	Swiss-Prot	strong database homology
`Q9M2S9`	Arabidopsis thaliana	Expansin-A16	57.205%	Swiss-Prot	strong database homology
`Q9FMA0`	Arabidopsis thaliana	Expansin-A14	56.828%	Swiss-Prot	strong database homology
`Q7XUD0`	Oryza sativa subsp. japonica	Expansin-A10	65.126%	Swiss-Prot	strong database homology
`Q40636`	Oryza sativa subsp. japonica	Expansin-A2	56.444%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card