LXL04_013579 | RubberDandelionOmics

Gene overview

LXL04_013579

Reference: OH-1004 Chr: Chr03 Coordinates: 32066132-32068071 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

384 bp · LXL04_013579|LXL04_013579|OH1004|cDNA

ATGCCATTCTATTTTTTAGCCCAGTTGAACTGCGGGTTAAACCCTGAAATTGTTTTAACCAATTCACACAAAAACAATGGCTTGGCGTTGCGCCGTTGCGGATCCCTGCCGAGGTCGCTGATTTCCACCGCCAGATCTTCAACAATCCGTCGTCCGACCACCACTTCCCTCCCTCATCTACGTCCTCCTCCGCAACCAAGCCTACACGGCCATCGCCTCCGTCCCGGCCCCACGCCTTCCCTCCCTGGTTTCGGGACTAT...

CDS

Download CDS FASTA

384 bp · LXL04_013579|LXL04_013579|OH1004|CDS

ATGCCATTCTATTTTTTAGCCCAGTTGAACTGCGGGTTAAACCCTGAAATTGTTTTAACCAATTCACACAAAAACAATGGCTTGGCGTTGCGCCGTTGCGGATCCCTGCCGAGGTCGCTGATTTCCACCGCCAGATCTTCAACAATCCGTCGTCCGACCACCACTTCCCTCCCTCATCTACGTCCTCCTCCGCAACCAAGCCTACACGGCCATCGCCTCCGTCCCGGCCCCACGCCTTCCCTCCCTGGTTTCGGGACTAT...

Protein

Download Protein FASTA

127 aa · LXL04_013579|LXL04_013579|OH1004|PROTEIN

MPFYFLAQLNCGLNPEIVLTNSHKNNGLALRRCGSLPRSLISTARSSTIRRPTTTSLPHLRPPPQPSLHGHRLRPGPTPSLPGFGTIGGVLGCTQSLLPLHSVVAAARLTSHVAVDARACCELSQGT

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_013579`
TK1151 ID	TkA02G487080
OH-1004 ID	LXL04_013579
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 19.745 / OH-1004 24.409 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_013579

Location Chr03:32066132-32068071 (+)

Description Similar to NOXY2: Protein NONRESPONDING TO OXYLIPINS 2, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g11630`	Essential for mitochondrial morphology, functionality and distribution.	Oxylipins produced by the 9-lipoxygenase pathway in Arabidopsis regulate lateral root development and defense responses through a specific signaling cascade.2007 · DOI: 10.1105/tpc.106.046052 Defense activated by 9-lipoxygenase-derived oxylipins requires specific mitochondrial proteins.2013 · DOI: 10.1104/pp.112.207514 9-Lipoxygenase-Derived Oxylipins Activate Brassinosteroid Signaling to Promote Cell Wall-Based Defense and Limit Pathogen Infection.2015 · DOI: 10.1104/pp.15.00992

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013579 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009617 response to bacterium Biological Process

GO:0009635 response to herbicide Biological Process

GO:0010311 lateral root formation Biological Process

GO:0010821 regulation of mitochondrion organization Biological Process

GO:0019372 lipoxygenase pathway Biological Process

GO:0031407 oxylipin metabolic process Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0048311 mitochondrion distribution Biological Process

GO:0048364 root development Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0052543 callose deposition in cell wall Biological Process

GO:0071433 cell wall repair Biological Process

KEGG gene cross-reference

ath:AT5G11630

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.515

Rank 1 · LXL04_013579 · OH-1004

Cytoplasm0.346

Rank 2 · LXL04_013579 · OH-1004

Cell membrane0.127

Rank 3 · LXL04_013579 · OH-1004

Endoplasmic reticulum0.088

Rank 4 · LXL04_013579 · OH-1004

Mitochondrion0.053

Rank 5 · LXL04_013579 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6NNL9`	Arabidopsis thaliana	Protein NONRESPONDING TO OXYLIPINS 2, mitochondrial	38.947%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card