LXL04_011777 | RubberDandelionOmics

Gene overview

LXL04_011777

Reference: OH-1004 Chr: Chr03 Coordinates: 43096-44064 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

603 bp · LXL04_011777|LXL04_011777|OH1004|cDNA

ATGACTTCAAGAAAGAAAAGCATGCTCGTTTGTGCGCTAGTAGGGATTCTAGGGTTTCTCTCTGCtgttttgagttttgttgcaGAGGCCAAGAGGATAAAGGGTTCGGAGGTTAGGTTTTCATCTCCATCTGAATGTGTGTACCCCCGGAGTCCAGCTCTAGCACTTGGATTAATGGCAGCTGTATGTCTGATGATTGCGCAAGTGATTATCAATGTTGCAACTGGTTGCATCTGTTGCAGAAAGTCATCAACCTCTAA...

CDS

Download CDS FASTA

603 bp · LXL04_011777|LXL04_011777|OH1004|CDS

ATGACTTCAAGAAAGAAAAGCATGCTCGTTTGTGCGCTAGTAGGGATTCTAGGGTTTCTCTCTGCTGTTTTGAGTTTTGTTGCAGAGGCCAAGAGGATAAAGGGTTCGGAGGTTAGGTTTTCATCTCCATCTGAATGTGTGTACCCCCGGAGTCCAGCTCTAGCACTTGGATTAATGGCAGCTGTATGTCTGATGATTGCGCAAGTGATTATCAATGTTGCAACTGGTTGCATCTGTTGCAGAAAGTCATCAACCTCTAA...

Protein

Download Protein FASTA

200 aa · LXL04_011777|LXL04_011777|OH1004|PROTEIN

MTSRKKSMLVCALVGILGFLSAVLSFVAEAKRIKGSEVRFSSPSECVYPRSPALALGLMAAVCLMIAQVIINVATGCICCRKSSTSNWTLPILCFVLSWLTFVIAFLLLLTGAALNDEHGEENMYFGSYNCYVVKPGVFAGAASLSLASVVLGIMYYYSVSLAATKVLNGDGGAIVMGQPQQHDPVFVHEDTYARRQAYS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_011777`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_011777

Location Chr03:43096-44064 (-)

Description Similar to MWL1: Protein MODIFYING WALL LIGNIN-1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g31720`	Together with MWL2, contributes to secondary cell wall biology, specifically lignin biosynthesis.	The Arabidopsis Domain of Unknown Function 1218 (DUF1218) Containing Proteins, MODIFYING WALL LIGNIN-1 and 2 (At1g31720/MWL-1 and At4g19370/MWL-2) Function Redundantly to Alter Secondary Cell Wall Lignin Content.2016 · DOI: 10.1371/journal.pone.0150254
`At4g19370`	Together with MWL1, contributes to secondary cell wall biology, specifically lignin biosynthesis.	The Arabidopsis Domain of Unknown Function 1218 (DUF1218) Containing Proteins, MODIFYING WALL LIGNIN-1 and 2 (At1g31720/MWL-1 and At4g19370/MWL-2) Function Redundantly to Alter Secondary Cell Wall Lignin Content.2016 · DOI: 10.1371/journal.pone.0150254
`At2g32280`	Required, together with OPS, for embryo provasculature development and cotyledon vascular complexity and connectivity.	Members of the DEAL subfamily of the DUF1218 gene family are required for bilateral symmetry but not for dorsoventrality in Arabidopsis leaves.2018 · DOI: 10.1111/nph.14898
`At4g21310`	Involved, partially redundantly with VCC/DEAL1 and DEAL3, to ensure bilateral symmetry development and early leaf margin patterning, probably via the regulation of auxin and CUC2 distribution.	Members of the DEAL subfamily of the DUF1218 gene family are required for bilateral symmetry but not for dorsoventrality in Arabidopsis leaves.2018 · DOI: 10.1111/nph.14898

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011777 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009808 lignin metabolic process Biological Process

GO:0009809 lignin biosynthetic process Biological Process

GO:0009855 determination of bilateral symmetry Biological Process

GO:0010087 phloem or xylem histogenesis Biological Process

GO:0010305 leaf vascular tissue pattern formation Biological Process

GO:0010588 cotyledon vascular tissue pattern formation Biological Process

GO:0048366 leaf development Biological Process

GO:0048825 cotyledon development Biological Process

GO:0140964 intracellular auxin homeostasis Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT1G31720

ath:AT2G32280

ath:AT4G19370

ath:AT4G21310

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.694

Rank 1 · LXL04_011777 · OH-1004

Lysosome / Vacuole0.129

Rank 2 · LXL04_011777 · OH-1004

Endoplasmic reticulum0.107

Rank 3 · LXL04_011777 · OH-1004

Cytoplasm0.107

Rank 4 · LXL04_011777 · OH-1004

Nucleus0.055

Rank 5 · LXL04_011777 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06749.18DUF121860-150 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_011777	`PF06749.18`	DUF1218	60	150	4.7e-28	98.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`A2RVU1`	Arabidopsis thaliana	Protein MODIFYING WALL LIGNIN-1	33.058%	Swiss-Prot	moderate database homology
`O65708`	Arabidopsis thaliana	Protein MODIFYING WALL LIGNIN-2	25.888%	Swiss-Prot	weak database homology
`Q9ZV57`	Arabidopsis thaliana	Protein VASCULATURE COMPLEXITY AND CONNECTIVITY	29.752%	Swiss-Prot	weak database homology
`O81898`	Arabidopsis thaliana	Protein DESIGUAL 2	23.729%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card