Gene Card
Gene overview
cDNA / CDS / Protein Sequences
252 bp · LXL04_010112|LXL04_010112|OH1004|cDNA
ATGACGACTGAGGCCACTGGAATCATCAATCAATCTTTTGAAAGGCGTTCTGCCGATTACAAACCAAACATTTGGAACTACGATCTCCTACAATCTCTGCAATGTGAATTTCATGAAGAAGAATATAGATTACAAGTTCAGAAGGCTAGAGAAGAAGTTAAAGCTTATTTGTTGAGACAGTGGAACCTGTGGCGAAAGCACAACTTCTCTTGCATTCCATTCCATAACTTCCTTACTCAAGAATACAATTAA
252 bp · LXL04_010112|LXL04_010112|OH1004|CDS
ATGACGACTGAGGCCACTGGAATCATCAATCAATCTTTTGAAAGGCGTTCTGCCGATTACAAACCAAACATTTGGAACTACGATCTCCTACAATCTCTGCAATGTGAATTTCATGAAGAAGAATATAGATTACAAGTTCAGAAGGCTAGAGAAGAAGTTAAAGCTTATTTGTTGAGACAGTGGAACCTGTGGCGAAAGCACAACTTCTCTTGCATTCCATTCCATAACTTCCTTACTCAAGAATACAATTAA
Protein
Download Protein FASTA83 aa · LXL04_010112|LXL04_010112|OH1004|PROTEIN
MTTEATGIINQSFERRSADYKPNIWNYDLLQSLQCEFHEEEYRLQVQKAREEVKAYLLRQWNLWRKHNFSCIPFHNFLTQEYN
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_010112 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_010112 |
|---|---|
| Location | Chr02:140379868-140381136 (+) |
| Description | Similar to TPS7: Alpha-farnesene synthase |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0016102 diterpenoid biosynthetic process Biological Process GO:0033383 geranyl diphosphate metabolic process Biological Process GO:0046246 terpene biosynthetic process Biological Process GO:0046248 alpha-pinene biosynthetic process Biological Process GO:0051762 sesquiterpene biosynthetic process Biological Process GO:0005737 cytoplasm Cellular Component GO:0009507 chloroplast Cellular Component GO:0000287 magnesium ion binding Molecular Function GO:0010333 terpene synthase activity Molecular Function GO:0010334 sesquiterpene synthase activity Molecular Function GO:0016740 transferase activity Molecular Function GO:0050550 pinene synthase activity Molecular Function |
| KEGG gene cross-reference | ag:AAM53943 mdm:103446592 rcu:8267421 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
No result was found for this query.
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.