LXL04_010033 | RubberDandelionOmics

Gene overview

LXL04_010033

Reference: OH-1004 Chr: Chr02 Coordinates: 138551099-138566225 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3054 bp · LXL04_010033|LXL04_010033|OH1004|cDNA

atggctgaagacaaggttgtaatcgagaatttcaacggttctgactttagctggtggaaaatgcaattagaagcattgctatgtcagaaagacttggacatggtactcggagacaaaccggagaaaatggaaaaagctgcagaagatgcgtggaactcaaaggacaagaaagccaatGCGGTTATTTCAttgtcgttgacgaagagcgttgctttcaacatcatgaatgaaaccacggcgcgtggtatgatggaggctct...

CDS

Download CDS FASTA

3054 bp · LXL04_010033|LXL04_010033|OH1004|CDS

ATGGCTGAAGACAAGGTTGTAATCGAGAATTTCAACGGTTCTGACTTTAGCTGGTGGAAAATGCAATTAGAAGCATTGCTATGTCAGAAAGACTTGGACATGGTACTCGGAGACAAACCGGAGAAAATGGAAAAAGCTGCAGAAGATGCGTGGAACTCAAAGGACAAGAAAGCCAATGCGGTTATTTCATTGTCGTTGACGAAGAGCGTTGCTTTCAACATCATGAATGAAACCACGGCGCGTGGTATGATGGAGGCTCT...

Protein

Download Protein FASTA

1017 aa · LXL04_010033|LXL04_010033|OH1004|PROTEIN

MAEDKVVIENFNGSDFSWWKMQLEALLCQKDLDMVLGDKPEKMEKAAEDAWNSKDKKANAVISLSLTKSVAFNIMNETTARGMMEALSNMYEKPSAANKVFLMRELFTTRMNEEGSVTVHINNLNSILSRLSSVGIKFDNDTQASLLLASLPDSWSGTVTAVTSSVGTSGMTFEGVRDLVLGEDIRRKNQGGSFSSDLLNVGRGRGNSRKSGSSGSRGKSSSRTLKNVKCWNCQEDDALILSMESSVDSWVMDSGASFHA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_010033`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_010033

Location Chr02:138551099-138566225 (-)

Description Similar to DEK1: Calpain-type cysteine protease DEK1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g55350`	Essential protease involved in epiderm development.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0709400`	Essential protease involved in epiderm development.	Initiation of shoot apical meristem in rice: characterization of four SHOOTLESS genes.1999 · DOI: 10.1242/dev.126.16.3629 The ADAXIALIZED LEAF1 gene functions in leaf and embryonic pattern formation in rice.2009 · DOI: 10.1016/j.ydbio.2009.07.042

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010033 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0001558 regulation of cell growth Biological Process

GO:0001708 cell fate specification Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0009934 regulation of meristem structural organization Biological Process

GO:0032877 positive regulation of DNA endoreduplication Biological Process

GO:0040014 regulation of multicellular organism growth Biological Process

GO:0042127 regulation of cell population proliferation Biological Process

GO:0090392 sepal giant cell differentiation Biological Process

GO:0090628 plant epidermal cell fate specification Biological Process

GO:0097264 self proteolysis Biological Process

GO:2000011 regulation of adaxial/abaxial pattern formation Biological Process

GO:2000014 regulation of endosperm development Biological Process

KEGG gene cross-reference

ath:AT1G55350

dosa:Os02g0709400

osa:4330484

zma:542509

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.612

Rank 1 · LXL04_010033 · OH-1004

Nucleus0.439

Rank 2 · LXL04_010033 · OH-1004

Cell membrane0.073

Rank 3 · LXL04_010033 · OH-1004

Mitochondrion0.071

Rank 4 · LXL04_010033 · OH-1004

Endoplasmic reticulum0.066

Rank 5 · LXL04_010033 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14223.15Retrotran_gag_224-191 aa

PF22936.2Pol_BBD250-330 aa

PF00648.28Peptidase_C2565-713 aa

PF00648.28Peptidase_C2783-931 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_010033	`PF14223.15`	Retrotran_gag_2	24	191	7.2e-33	114.4
LXL04_010033	`PF22936.2`	Pol_BBD	250	330	1.3e-20	74.2
LXL04_010033	`PF00648.28`	Peptidase_C2	565	713	1.2e-59	202.6
LXL04_010033	`PF00648.28`	Peptidase_C2	783	931	1.2e-59	202.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8RVL2`	Arabidopsis thaliana	Calpain-type cysteine protease DEK1	58.898%	Swiss-Prot	weak database homology
`Q6ZFZ4`	Oryza sativa subsp. japonica	Calpain-type cysteine protease ADL1	62.736%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card