LXL04_009636 | RubberDandelionOmics

Gene overview

LXL04_009636

Reference: OH-1004 Chr: Chr02 Coordinates: 130148366-130150094 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1348 bp · LXL04_009636|LXL04_009636|OH1004|cDNA

TCAAATGACAAATGGTGTCTTTCTTGTTCTTCAccaaagagaaaaaaaaaaagaaacatcTGTTTCGGACCGTTGTGGGTGGTTCCTCCTTCCCTCACTCACGCAGCATTCCACGCCACCACCCGCCACCCACCACCACCGCCGTGACAGGACAACGATTGCCTTTATACAACCGCAGAAGAACACAAAAGCAAAACTCCAAGAACATAAATATTCCATTGCTCACATGGATCTACTCTCTTCTTCCTATGCTACTCACC...

CDS

Download CDS FASTA

1344 bp · LXL04_009636|LXL04_009636|OH1004|CDS

ATGACAAATGGTGTCTTTCTTGTTCTTCACCAAAGAGAAAAAAAAAAAGAAACATCTGTTTCGGACCGTTGTGGGTGGTTCCTCCTTCCCTCACTCACGCAGCATTCCACGCCACCACCCGCCACCCACCACCACCGCCGTGACAGGACAACGATTGCCTTTATACAACCGCAGAAGAACACAAAAGCAAAACTCCAAGAACATAAATATTCCATTGCTCACATGGATCTACTCTCTTCTTCCTATGCTACTCACCTTAT...

Protein

Download Protein FASTA

447 aa · LXL04_009636|LXL04_009636|OH1004|PROTEIN

MTNGVFLVLHQREKKKETSVSDRCGWFLLPSLTQHSTPPPATHHHRRDRTTIAFIQPQKNTKAKLQEHKYSIAHMDLLSSSYATHLISFFLALSLLSKGVFGASFTFVNKCDYTVWPGILANAGSPSLDTTGFELPEDSSRSFQAPTGWSGRFWGRTNCKFDRSGSGTCQSADCGSGQVECNGAGAAPPATLAEFTLGTGGSDFYDVSLVDGYNIAMIVEASGGSGLCATTGCVNDLNQQCPSELRVESGQGCKSACEAF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_009636`
TK1151 ID	TkA02G370110
OH-1004 ID	LXL04_009636
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	66.100
Protein coverage (%)	TK1151 76.341 / OH-1004 53.244 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_009636

Location Chr02:130148366-130150094 (+)

Description Similar to TLP1: Thaumatin-like protein 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g24180`	Involved in local responses of roots to colonization by non-pathogenic plant growth-promoting rhizobacteria (PGPR) fluorescent Pseudomonas spp., but does not seem to be required for the establishment of subsequent induced systemic resistance (ISR).	No verified direct reference in this release
`At1g18250`	Thaumatin-like protein.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009636 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0009617 response to bacterium Biological Process

GO:0009682 induced systemic resistance Biological Process

GO:0009723 response to ethylene Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0005576 extracellular region Cellular Component

KEGG gene cross-reference

ath:AT1G18250

ath:AT4G24180

mdm:103411735

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.353

Rank 1 · LXL04_009636 · OH-1004

Cell membrane0.194

Rank 2 · LXL04_009636 · OH-1004

Endoplasmic reticulum0.174

Rank 3 · LXL04_009636 · OH-1004

Lysosome / Vacuole0.147

Rank 4 · LXL04_009636 · OH-1004

Cytoplasm0.135

Rank 5 · LXL04_009636 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00314.23Thaumatin109-318 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_009636	`PF00314.23`	Thaumatin	109	318	4.2e-83	278.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`A0A1P8B554`	Arabidopsis thaliana	Thaumatin-like protein 1	66.265%	Swiss-Prot	moderate database homology
`P50699`	Arabidopsis thaliana	Thaumatin-like protein	57.466%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card