RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

LXL04_009244
Reference: OH-1004 Chr: Chr02 Coordinates: 121264220-121266127 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1182 bp · LXL04_009244|LXL04_009244|OH1004|cDNA

ATGGCACCAACTCCATACAGTTCCCTCTACGACAACCCCCTTACGGAGCTCAAACACAGTCGGAGCTCCAGTGAATGCAACAATGGCGTTTTGACCGTTCACAATCGTCAAAACAAAGAGAACTCGGAGCCGAATAAAGTGAAGACAAACTCGGGTCCTGTTGTGGATAAGGAGAATGTGGATTCTAACATAATTGGGTGTAAACCAGCACCAATCGCGAAATCCCGTTTGAAAGATAGGGCTTGGAAACCGTCTTCGTT...

CDS

Download CDS FASTA

1182 bp · LXL04_009244|LXL04_009244|OH1004|CDS

ATGGCACCAACTCCATACAGTTCCCTCTACGACAACCCCCTTACGGAGCTCAAACACAGTCGGAGCTCCAGTGAATGCAACAATGGCGTTTTGACCGTTCACAATCGTCAAAACAAAGAGAACTCGGAGCCGAATAAAGTGAAGACAAACTCGGGTCCTGTTGTGGATAAGGAGAATGTGGATTCTAACATAATTGGGTGTAAACCAGCACCAATCGCGAAATCCCGTTTGAAAGATAGGGCTTGGAAACCGTCTTCGTT...

Protein

Download Protein FASTA

393 aa · LXL04_009244|LXL04_009244|OH1004|PROTEIN

MAPTPYSSLYDNPLTELKHSRSSSECNNGVLTVHNRQNKENSEPNKVKTNSGPVVDKENVDSNIIGCKPAPIAKSRLKDRAWKPSSLQLCMQLDDPIPNFGTSFYEPIDSAKNNSGNIWDYSDSEAAPASSWSTLPNRSLLCRPLPVDIGRCTCIIVKEKSVDGINGGSVYTLYTNEGQGRQNRKLAVALHRRHNGRSEFIIAQNTKGILCFADDSYVGSVTANLMGSKYHIWDQGRRLNSMTKNSKLLAVVSFVPTIAT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDLXL04_009244
Source versionOH-1004 / GCA_047496595.1_OSU_TarKok_2.0
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDLXL04_009244
LocationChr02:121264220-121266127 (-)
DescriptionSimilar to TULP8: Tubby-like protein 8
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g16070 Tubby-like protein 8. No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
Os02g0179400 Tubby-like protein 4. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_009244 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)
GO:0006355 regulation of DNA-templated transcription Biological Process
GO:0007186 G protein-coupled receptor signaling pathway Biological Process
GO:0008277 regulation of G protein-coupled receptor signaling pathway Biological Process
GO:0009620 response to fungus Biological Process
GO:0045879 negative regulation of smoothened signaling pathway Biological Process
GO:0061512 protein localization to cilium Biological Process
GO:0097499 protein localization to non-motile cilium Biological Process
GO:0005576 extracellular region Cellular Component
GO:0005634 nucleus Cellular Component
GO:0005654 nucleoplasm Cellular Component
GO:0005730 nucleolus Cellular Component
GO:0005737 cytoplasm Cellular Component
KEGG gene cross-reference
ath:AT1G16070
cqu:CpipJ_CPIJ006491
cqu:CpipJ_CPIJ017614
hsa:7289
osa:107276884
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.473
Rank 1 · LXL04_009244 · OH-1004
Nucleus0.317
Rank 2 · LXL04_009244 · OH-1004
Cell membrane0.217
Rank 3 · LXL04_009244 · OH-1004
Endoplasmic reticulum0.083
Rank 4 · LXL04_009244 · OH-1004
Golgi apparatus0.079
Rank 5 · LXL04_009244 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01167.25Tub141-387 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
LXL04_009244PF01167.25Tub1413877e-48164.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9S9M8Arabidopsis thalianaTubby-like protein 852.196%Swiss-Protstrong database homology
Q6ETL2Oryza sativa subsp. japonicaTubby-like protein 462.766%Swiss-Protmoderate database homology

JBrowse

View in Genome Browser