LXL04_009165 | RubberDandelionOmics

Gene overview

LXL04_009165

Reference: OH-1004 Chr: Chr02 Coordinates: 119432095-119433722 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1101 bp · LXL04_009165|LXL04_009165|OH1004|cDNA

ATGGATTTTCGCTCCTTCTTTTGCTGCATAAGGGTTTCCGATCGgaaagagaaagagaagaaacaATCAACATGGAGGATATTTTCATTGAAGGAATTACATGCTGCCACCAACAATTTCAATTACGACAACAAGCTTGGTGAAGGCGGATTTGGCAGCGTTTATTGGGGTCAACTATGGGACGGATCTCAAATTGCAGTAAAAAGATTAAAAGTCTATAGCAACAAAGCCGAAATGGAATTCGCTGTTGAAGTTGAGAT...

CDS

Download CDS FASTA

1101 bp · LXL04_009165|LXL04_009165|OH1004|CDS

ATGGATTTTCGCTCCTTCTTTTGCTGCATAAGGGTTTCCGATCGGAAAGAGAAAGAGAAGAAACAATCAACATGGAGGATATTTTCATTGAAGGAATTACATGCTGCCACCAACAATTTCAATTACGACAACAAGCTTGGTGAAGGCGGATTTGGCAGCGTTTATTGGGGTCAACTATGGGACGGATCTCAAATTGCAGTAAAAAGATTAAAAGTCTATAGCAACAAAGCCGAAATGGAATTCGCTGTTGAAGTTGAGAT...

Protein

Download Protein FASTA

366 aa · LXL04_009165|LXL04_009165|OH1004|PROTEIN

MDFRSFFCCIRVSDRKEKEKKQSTWRIFSLKELHAATNNFNYDNKLGEGGFGSVYWGQLWDGSQIAVKRLKVYSNKAEMEFAVEVEILARVRHKNLLSLRGYCAEGQERLIVYDYMPNLSLLSHLHGQHSSEILLDWPRRMTIAIGSAEGIVYLHHQATPHIIHRDVKASNVLLDSEFKAQVADFGFAKLIPDGATHVTTRVKGTLGYLAPEYAMLGKASESCDVYSFGILLLELASGKKPIEKLNSTTRRSITEWALPL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_009165`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_009165

Location Chr02:119432095-119433722 (+)

Description Similar to At3g15890: PTI1-like tyrosine-protein kinase At3g15890

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g15890`	PTI1-like tyrosine-protein kinase At3g15890.	No verified direct reference in this release
`At1g70460`	Negatively regulates root hair elongation.	No verified direct reference in this release
`At4g33430`	Dual specificity kinase acting on both serine/threonine- and tyrosine-containing substrates.	The BRI1-associated kinase 1, BAK1, has a brassinolide-independent role in plant cell-death control.2007 · DOI: 10.1016/j.cub.2007.05.046 BAK1 and BKK1 regulate brassinosteroid-dependent growth and brassinosteroid-independent cell-death pathways.2007 · DOI: 10.1016/j.cub.2007.05.036 Arabidopsis SOMATIC EMBRYOGENESIS RECEPTOR KINASE proteins serve brassinosteroid-dependent and -independent signaling pathways.2008 · DOI: 10.1104/pp.108.123216 Tyrosine phosphorylation of the BRI1 receptor kinase emerges as a component of brassinosteroid signaling in Arabidopsis.2009 · DOI: 10.1073/pnas.0810249106 Phosphorylation of receptor-like cytoplasmic kinases by bacterial flagellin.2010 · DOI: 10.4161/psb.11500 The Arabidopsis leucine-rich repeat receptor-like kinases BAK1/SERK3 and BKK1/SERK4 are required for innate immunity to hemibiotrophic and biotrophic pathogens.2011 · DOI: 10.1105/tpc.111.084301 Structure of the pseudokinase domain of BIR2, a regulator of BAK1-mediated immune signaling in Arabidopsis.2014 · DOI: 10.1016/j.jsb.2014.02.005 Phytosulfokine Regulates Growth in Arabidopsis through a Response Module at the Plasma Membrane That Includes CYCLIC NUCLEOTIDE-GATED CHANNEL17, H+-ATPase, and BAK1.2015 · DOI: 10.1105/tpc.15.00306 An RLP23-SOBIR1-BAK1 complex mediates NLP-triggered immunity.2015 · DOI: 10.1038/nplants.2015.140 The SCOOP12 peptide regulates defense response and root elongation in Arabidopsis thaliana.2019 · DOI: 10.1093/jxb/ery454 The Arabidopsis MIK2 receptor elicits immunity by sensing a conserved signature from phytocytokines and microbes.2021 · DOI: 10.1038/s41467-021-25580-w
`At3g24540`	Proline-rich receptor-like protein kinase PERK3.	No verified direct reference in this release
`At1g68690`	Could be involved in the negative regulation of root growth.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009165 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002229 defense response to oomycetes Biological Process

GO:0006995 cellular response to nitrogen starvation Biological Process

GO:0007165 signal transduction Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:0016036 cellular response to phosphate starvation Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:1990641 response to iron ion starvation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005768 endosome Cellular Component

KEGG gene cross-reference

ath:AT1G68690

ath:AT1G70460

ath:AT3G15890

ath:AT4G33430

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.648

Rank 1 · LXL04_009165 · OH-1004

Cytoplasm0.290

Rank 2 · LXL04_009165 · OH-1004

Nucleus0.214

Rank 3 · LXL04_009165 · OH-1004

Endoplasmic reticulum0.041

Rank 4 · LXL04_009165 · OH-1004

Golgi apparatus0.033

Rank 5 · LXL04_009165 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069.32Pkinase41-308 aa

PF07714.24PK_Tyr_Ser-Thr42-310 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_009165	`PF00069.32`	Pkinase	41	308	6.4e-42	144.5
LXL04_009165	`PF07714.24`	PK_Tyr_Ser-Thr	42	310	2e-43	149.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LSC2`	Arabidopsis thaliana	PTI1-like tyrosine-protein kinase At3g15890	63.842%	Swiss-Prot	strong database homology
`Q9CAL8`	Arabidopsis thaliana	Proline-rich receptor-like protein kinase PERK13	49.169%	Swiss-Prot	moderate database homology
`Q94F62`	Arabidopsis thaliana	BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1	46.732%	Swiss-Prot	moderate database homology
`Q1PEM5`	Arabidopsis thaliana	Proline-rich receptor-like protein kinase PERK3	45.370%	Swiss-Prot	moderate database homology
`Q9SX31`	Arabidopsis thaliana	Proline-rich receptor-like protein kinase PERK9	46.154%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card