LXL04_009060 | RubberDandelionOmics

Gene overview

LXL04_009060

Reference: OH-1004 Chr: Chr02 Coordinates: 117077983-117079181 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

687 bp · LXL04_009060|LXL04_009060|OH1004|cDNA

ATGTCCAAAGTTCGAGCATTATGGCAAGCTTCTTTAACCGCCACTAAAAGAGCTCTCTCATGGAACCTTGATGACATGCTTCCTCCTAGTGAGAGATTTATATACAACTTCAGTTCCAAAGAAGAGCTTAAAAAATGGCATTTATATTCAGATTCTGAATACGGAGGTTTGTCATCCGCAGCATTAGAGATCACTGATGCTGGAAATGAACAGAGTGGTGGTACTGGAGTTTTCTCTGGGAATCTTTCTCTTGATGTCAC...

CDS

Download CDS FASTA

687 bp · LXL04_009060|LXL04_009060|OH1004|CDS

ATGTCCAAAGTTCGAGCATTATGGCAAGCTTCTTTAACCGCCACTAAAAGAGCTCTCTCATGGAACCTTGATGACATGCTTCCTCCTAGTGAGAGATTTATATACAACTTCAGTTCCAAAGAAGAGCTTAAAAAATGGCATTTATATTCAGATTCTGAATACGGAGGTTTGTCATCCGCAGCATTAGAGATCACTGATGCTGGAAATGAACAGAGTGGTGGTACTGGAGTTTTCTCTGGGAATCTTTCTCTTGATGTCAC...

Protein

Download Protein FASTA

228 aa · LXL04_009060|LXL04_009060|OH1004|PROTEIN

MSKVRALWQASLTATKRALSWNLDDMLPPSERFIYNFSSKEELKKWHLYSDSEYGGLSSAALEITDAGNEQSGGTGVFSGNLSLDVTDGTKWNISRSGFCGMRSKKFDGFIDLDPYDTIALKVRGDGRSYISTIYTENWVNSPGQMEDNSWQAFVSVPKNNWVVAKIPLVHYLPTWRGNVIEAEIEMNQARVVGMSFSVNAEGGVPGAQTGPGDFRLEIDWIKALRTQ

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_009060`
TK1151 ID	TkA03G395460
OH-1004 ID	LXL04_009060
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	84.300
Protein coverage (%)	TK1151 95.025 / OH-1004 83.772 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_009060

Location Chr02:117077983-117079181 (-)

Description Similar to At1g17350: Probable complex I intermediate-associated protein 30

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g17350`	Chaperone protein involved in the assembly of the mitochondrial NADH:ubiquinone oxidoreductase complex (complex I).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009060 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0001666 response to hypoxia Biological Process

GO:0006120 mitochondrial electron transport, NADH to ubiquinone Biological Process

GO:0009408 response to heat Biological Process

GO:0010257 NADH dehydrogenase complex assembly Biological Process

GO:0032981 mitochondrial respiratory chain complex I assembly Biological Process

GO:0042594 response to starvation Biological Process

GO:0055093 response to hyperoxia Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005759 mitochondrial matrix Cellular Component

GO:0160295 mitochondrial complex I intermediate assembly complex Cellular Component

GO:0051082 unfolded protein binding Molecular Function

KEGG gene cross-reference

ath:AT1G17350

cel:CELE_C50B8.3

dme:Dmel_CG7598

ggo:101134200

ncr:NCU01975

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.932

Rank 1 · LXL04_009060 · OH-1004

Cytoplasm0.090

Rank 2 · LXL04_009060 · OH-1004

Nucleus0.050

Rank 3 · LXL04_009060 · OH-1004

Cell membrane0.029

Rank 4 · LXL04_009060 · OH-1004

Plastid0.028

Rank 5 · LXL04_009060 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08547.19CIA3036-219 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_009060	`PF08547.19`	CIA30	36	219	6.1e-42	144.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LQI7`	Arabidopsis thaliana	Probable complex I intermediate-associated protein 30	73.451%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card