Gene Card
Gene overview
cDNA / CDS / Protein Sequences
419 bp · LXL04_008937|LXL04_008937|OH1004|cDNA
TATAATATATACTAATCGTTGACTTCATTGAACAGTAAAGTCAACTATGTACAGTATTTTTTTTTCTCACGCTTCTTTCATTTGATCGGTCGGAAAGCTGTGGGAGAAGGAGAAAGAAAACAATGAAGAAAGAAGACACCGTAAAGCTCATCAGTGCAGAGGGTTTCGAATTTGTCATCGACAAGAATGCCGCCATGGTTTCTCAAACCATCCGCAACATGCTCACTTCTCCAGGCGATTTTGCGGAAACCGAGCGCCAG...
297 bp · LXL04_008937|LXL04_008937|OH1004|CDS
ATGAAGAAAGAAGACACCGTAAAGCTCATCAGTGCAGAGGGTTTCGAATTTGTCATCGACAAGAATGCCGCCATGGTTTCTCAAACCATCCGCAACATGCTCACTTCTCCAGGCGATTTTGCGGAAACCGAGCGCCAGGAAGTAAGATTTCCGGAAATAAGCACCACCATTCTGGAAAAAATCTGCCAGTACTTTTACTGGTCTCTTCAATATGCCAGCGGGAAGGAGACTGAATTCCACATTGAACCTGAATTGACATT...
Protein
Download Protein FASTA98 aa · LXL04_008937|LXL04_008937|OH1004|PROTEIN
MKKEDTVKLISAEGFEFVIDKNAAMVSQTIRNMLTSPGDFAETERQEVRFPEISTTILEKICQYFYWSLQYASGKETEFHIEPELTLELMMAANYLHT
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_008937 |
|---|---|
| TK1151 ID | TkA01G602540 |
| OH-1004 ID | LXL04_008937 |
| Relationship / confidence | Multi Candidate From Tk1151 / Complex relationship |
| Protein identity (%) | 100.000 |
| Protein coverage (%) | TK1151 69.504 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_008937 |
|---|---|
| Location | Chr02:113322081-113322956 (-) |
| Description | Similar to Eloc: Elongin-C |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0006357 regulation of transcription by RNA polymerase II Biological Process GO:0006367 transcription initiation at RNA polymerase II promoter Biological Process GO:0006368 transcription elongation by RNA polymerase II Biological Process GO:0006511 ubiquitin-dependent protein catabolic process Biological Process GO:0016567 protein ubiquitination Biological Process GO:0032968 positive regulation of transcription elongation by RNA polymerase II Biological Process GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process Biological Process GO:0140627 ubiquitin-dependent protein catabolic process via the C-end degron rule pathway Biological Process GO:0140958 target-directed miRNA degradation Biological Process GO:1990116 ribosome-associated ubiquitin-dependent protein catabolic process Biological Process |
| KEGG gene cross-reference | bta:540859 hsa:6921 mmu:67923 rno:64525 spo:2539714 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF03931.22Skp1_POZ6-66 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_008937 | PF03931.22 | Skp1_POZ | 6 | 66 | 3e-09 | 37.6 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.