LXL04_008036 | RubberDandelionOmics

Gene overview

LXL04_008036

Reference: OH-1004 Chr: Chr02 Coordinates: 81389411-81393427 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2499 bp · LXL04_008036|LXL04_008036|OH1004|cDNA

ATGAGATGGGTCGATGATAGAAACAAAGGGAGAAATGAGACGAATAACAACTCGTCAAAATGGAGATTTGTTGAAGCTACCTCCTTTTTCATCTCAAACCTCCCGGTTGAATGTGACATAAACCTGTTGAGGTCAAAACTGTCGAAGGAAGGAACTCTAGTAGACCTATTCATTGCAGCTAAGACTGATAAACATGGACACAAGCGCCTCTTTGCCAGAGTAGCCAAGTTTGAAAgaaaaggaaaagaagagaGCAAGGA...

CDS

Download CDS FASTA

2499 bp · LXL04_008036|LXL04_008036|OH1004|CDS

ATGAGATGGGTCGATGATAGAAACAAAGGGAGAAATGAGACGAATAACAACTCGTCAAAATGGAGATTTGTTGAAGCTACCTCCTTTTTCATCTCAAACCTCCCGGTTGAATGTGACATAAACCTGTTGAGGTCAAAACTGTCGAAGGAAGGAACTCTAGTAGACCTATTCATTGCAGCTAAGACTGATAAACATGGACACAAGCGCCTCTTTGCCAGAGTAGCCAAGTTTGAAAGAAAAGGAAAAGAAGAGAGCAAGGA...

Protein

Download Protein FASTA

832 aa · LXL04_008036|LXL04_008036|OH1004|PROTEIN

MRWVDDRNKGRNETNNNSSKWRFVEATSFFISNLPVECDINLLRSKLSKEGTLVDLFIAAKTDKHGHKRLFARVAKFERKGKEESKEPPRRYQEEKVEFTIDPQPRKVSFQVNKSFAEAVRGSKISAQADIWKEEVIIKIEPDVSYRRDGDLKESYIGEVKNYKALSCIQSVLIGEGFNQNSIDYLGGLWVLLTPKSDENRRKIKEDNNVLSWFNSIRLWSENFKVTDRIVWVQIEGVPVKIWSPNTFIKIASRWGEVLQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_008036`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_008036

Location Chr02:81389411-81393427 (-)

Description Similar to At3g55350: Protein ALP1-like

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g55350`	Transposase-derived protein that may have nuclease activity.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008036 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000118 histone deacetylase complex Cellular Component

GO:0005634 nucleus Cellular Component

GO:0004518 nuclease activity Molecular Function

GO:0016787 hydrolase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT3G55350

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.811

Rank 1 · LXL04_008036 · OH-1004

Cytoplasm0.248

Rank 2 · LXL04_008036 · OH-1004

Cell membrane0.031

Rank 3 · LXL04_008036 · OH-1004

Mitochondrion0.028

Rank 4 · LXL04_008036 · OH-1004

Endoplasmic reticulum0.021

Rank 5 · LXL04_008036 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF26138.1DUF8040528-614 aa

PF13359.13DDE_Tnp_4646-774 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_008036	`PF26138.1`	DUF8040	528	614	1.2e-21	77.1
LXL04_008036	`PF13359.13`	DDE_Tnp_4	646	774	4.8e-15	56.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M2U3`	Arabidopsis thaliana	Protein ALP1-like	24.885%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card