LXL04_006554 | RubberDandelionOmics

Gene overview

LXL04_006554

Reference: OH-1004 Chr: Chr02 Coordinates: 13328210-13329802 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

357 bp · LXL04_006554|LXL04_006554|OH1004|cDNA

ATGAGTATGTCGAGTGTACAAGATTCAGTTGTGATCAAATTCCGTTTAACCGACGGATCGGATATCGGTCCTAAAAGCTTCCCATCAGCCGCAAGTATTGCATCCTTGAAAGAAAGCATCATTTCTCAATGGCCTAGAGAGAAGGAGAACGCTCCACGAACCGTAAACAACATAAAATTAATTAGTGGCGGGAAAGTGTTGGAGAACAATGGAACAGTAGGCGAATGTCGGAGTCCGTTGTGTGATGTTATAACCATGCA...

CDS

Download CDS FASTA

357 bp · LXL04_006554|LXL04_006554|OH1004|CDS

ATGAGTATGTCGAGTGTACAAGATTCAGTTGTGATCAAATTCCGTTTAACCGACGGATCGGATATCGGTCCTAAAAGCTTCCCATCAGCCGCAAGTATTGCATCCTTGAAAGAAAGCATCATTTCTCAATGGCCTAGAGAGAAGGAGAACGCTCCACGAACCGTAAACAACATAAAATTAATTAGTGGCGGGAAAGTGTTGGAGAACAATGGAACAGTAGGCGAATGTCGGAGTCCGTTGTGTGATGTTATAACCATGCA...

Protein

Download Protein FASTA

118 aa · LXL04_006554|LXL04_006554|OH1004|PROTEIN

MSMSSVQDSVVIKFRLTDGSDIGPKSFPSAASIASLKESIISQWPREKENAPRTVNNIKLISGGKVLENNGTVGECRSPLCDVITMHVAISQPRQEKMVKRLSHHDKCWGWATKRTQS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_006554`
TK1151 ID	TkA03G047790
OH-1004 ID	LXL04_006554
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_006554

Location Chr02:13328210-13329802 (+)

Description Similar to MUB1: Membrane-anchored ubiquitin-fold protein 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g15460`	May serve as docking site to facilitate the association of other proteins to the plasma membrane.	No verified direct reference in this release
`At3g01050`	May serve as docking site to facilitate the association of other proteins to the plasma membrane.	No verified direct reference in this release
`At1g22050`	May serve as docking site to facilitate the association of other proteins to the plasma membrane.	No verified direct reference in this release
`At1g77870`	May serve as docking site to facilitate the association of other proteins to the plasma membrane.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0426800`	May serve as docking site to facilitate the association of other proteins to the plasma membrane.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006554 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT1G22050

ath:AT1G77870

ath:AT3G01050

ath:AT5G15460

dosa:Os03g0426800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.483

Rank 1 · LXL04_006554 · OH-1004

Nucleus0.391

Rank 2 · LXL04_006554 · OH-1004

Cell membrane0.167

Rank 3 · LXL04_006554 · OH-1004

Endoplasmic reticulum0.086

Rank 4 · LXL04_006554 · OH-1004

Mitochondrion0.062

Rank 5 · LXL04_006554 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13881.13Rad60-SLD_28-103 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_006554	`PF13881.13`	Rad60-SLD_2	8	103	3.7e-34	117.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LCS8`	Arabidopsis thaliana	Membrane-anchored ubiquitin-fold protein 2	58.511%	Swiss-Prot	strong database homology
`Q9MAB9`	Arabidopsis thaliana	Membrane-anchored ubiquitin-fold protein 1	58.586%	Swiss-Prot	strong database homology
`Q8GWJ6`	Arabidopsis thaliana	Membrane-anchored ubiquitin-fold protein 6	46.226%	Swiss-Prot	moderate database homology
`Q9SH14`	Arabidopsis thaliana	Membrane-anchored ubiquitin-fold protein 5	48.077%	Swiss-Prot	moderate database homology
`Q75GT2`	Oryza sativa subsp. japonica	Membrane-anchored ubiquitin-fold protein 1	54.000%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card