LXL04_006424 | RubberDandelionOmics

Gene overview

LXL04_006424

Reference: OH-1004 Chr: Chr02 Coordinates: 10390152-10391792 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

948 bp · LXL04_006424|LXL04_006424|OH1004|cDNA

ATGACAATGTTTTCCTCAAACCCTTTTCCCGAGCTTCCGTCATCCCCCGATAATCTCATTTTTCCACCCAATATTCTCTTTCACCATGAAAATGATAGTGCTTTCTTTAACTACCACCTGAATAACAGAGACCCACTTATCTCCGGCGACTGTCTTCATGATATCAGTCTTGCTACTCCTTCTCCGGTCATACCTACCACTTCTACAATCGAAGAAGATTTTAGTTGGCAGCAGCAGCAGGTTTTTGAAGATCATGACGA...

CDS

Download CDS FASTA

948 bp · LXL04_006424|LXL04_006424|OH1004|CDS

ATGACAATGTTTTCCTCAAACCCTTTTCCCGAGCTTCCGTCATCCCCCGATAATCTCATTTTTCCACCCAATATTCTCTTTCACCATGAAAATGATAGTGCTTTCTTTAACTACCACCTGAATAACAGAGACCCACTTATCTCCGGCGACTGTCTTCATGATATCAGTCTTGCTACTCCTTCTCCGGTCATACCTACCACTTCTACAATCGAAGAAGATTTTAGTTGGCAGCAGCAGCAGGTTTTTGAAGATCATGACGA...

Protein

Download Protein FASTA

315 aa · LXL04_006424|LXL04_006424|OH1004|PROTEIN

MTMFSSNPFPELPSSPDNLIFPPNILFHHENDSAFFNYHLNNRDPLISGDCLHDISLATPSPVIPTTSTIEEDFSWQQQQVFEDHDDLLDSVIASYKKTTAVSKKAGHSKIYTGRGLRDRRVRLSIDISRKFFCLQDLLGFDKASKTLDWLFGKCKTSIQELVKETNRCPSSTTTFQSKTSFLEAIMEGGDEGKSKKKSQLKYVDDKRKKVAENPTGGFQDNLAKDQSRAVARARARERAREKMRIRKLDDELKTLANDH...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_006424`
TK1151 ID	TkA03G035770
OH-1004 ID	LXL04_006424
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.300
Protein coverage (%)	TK1151 100.000 / OH-1004 90.794 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_006424

Location Chr02:10390152-10391792 (+)

Description Similar to TB1: Transcription factor TEOSINTE BRANCHED 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0706500`	Probable transcription factor that functions as a negative regulator of lateral branching, presumably through its expression in axillary buds.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006424 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0009799 specification of symmetry Biological Process

GO:0009908 flower development Biological Process

GO:0048262 determination of dorsal/ventral asymmetry Biological Process

GO:0048831 regulation of shoot system development Biological Process

GO:2000032 regulation of secondary shoot formation Biological Process

GO:0005634 nucleus Cellular Component

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0043565 sequence-specific DNA binding Molecular Function

KEGG gene cross-reference

dosa:Os03g0706500

osa:4333856

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.969

Rank 1 · LXL04_006424 · OH-1004

Cytoplasm0.100

Rank 2 · LXL04_006424 · OH-1004

Cell membrane0.028

Rank 3 · LXL04_006424 · OH-1004

Endoplasmic reticulum0.019

Rank 4 · LXL04_006424 · OH-1004

Plastid0.013

Rank 5 · LXL04_006424 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03634.20TCP103-245 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_006424	`PF03634.20`	TCP	103	245	7.3e-35	121.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LN68`	Oryza sativa subsp. japonica	Transcription factor TB1	34.123%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card