LXL04_005909 | RubberDandelionOmics

Gene overview

LXL04_005909

Reference: OH-1004 Chr: Chr01 Coordinates: 175597289-175597594 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

306 bp · LXL04_005909|LXL04_005909|OH1004|cDNA

ATGGAGAGAGTTAAGAGAATGGTTTCAGAGAGGCCAGTGGTGATATTTAGTAAGAGCTCTTGCATCTTATCGTACACAATCAAGACTTTGTTCAATGACTTGGCTGTGAACCCTACGGTCTATGAGCTTGATGAAATAGCAAGGAGTAGAGAGATCGAGCAGGCATTGTCGGGGATGGGGTGCAGTATGGTGCCGGCTGTTTTCATTGGTGGAGAGTTGGTTGGTGGAACTAATGAGATTATGAGTCTTCAGTTGAAGAG...

CDS

Download CDS FASTA

306 bp · LXL04_005909|LXL04_005909|OH1004|CDS

ATGGAGAGAGTTAAGAGAATGGTTTCAGAGAGGCCAGTGGTGATATTTAGTAAGAGCTCTTGCATCTTATCGTACACAATCAAGACTTTGTTCAATGACTTGGCTGTGAACCCTACGGTCTATGAGCTTGATGAAATAGCAAGGAGTAGAGAGATCGAGCAGGCATTGTCGGGGATGGGGTGCAGTATGGTGCCGGCTGTTTTCATTGGTGGAGAGTTGGTTGGTGGAACTAATGAGATTATGAGTCTTCAGTTGAAGAG...

Protein

Download Protein FASTA

101 aa · LXL04_005909|LXL04_005909|OH1004|PROTEIN

MERVKRMVSERPVVIFSKSSCILSYTIKTLFNDLAVNPTVYELDEIARSREIEQALSGMGCSMVPAVFIGGELVGGTNEIMSLQLKRDLKPMLIKAGALWV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_005909`
TK1151 ID	TkA01G007830
OH-1004 ID	LXL04_005909
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_005909

Location Chr01:175597289-175597594 (-)

Description Similar to GRXS3: Monothiol glutaredoxin-S3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g15700`	May only reduce GSH-thiol disulfides, but not protein disulfides.	No verified direct reference in this release
`At4g15670`	May only reduce GSH-thiol disulfides, but not protein disulfides.	No verified direct reference in this release
`At4g15690`	May only reduce GSH-thiol disulfides, but not protein disulfides.	No verified direct reference in this release
`At4g15680`	May only reduce GSH-thiol disulfides, but not protein disulfides.	No verified direct reference in this release
`At5g18600`	May only reduce GSH-thiol disulfides, but not protein disulfides.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005909 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process

GO:0010167 response to nitrate Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0046872 metal ion binding Molecular Function

GO:0051537 2 iron, 2 sulfur cluster binding Molecular Function

KEGG gene cross-reference

ath:AT4G15670

ath:AT4G15680

ath:AT4G15690

ath:AT4G15700

ath:AT5G18600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.624

Rank 1 · LXL04_005909 · OH-1004

Nucleus0.346

Rank 2 · LXL04_005909 · OH-1004

Cell membrane0.117

Rank 3 · LXL04_005909 · OH-1004

Mitochondrion0.060

Rank 4 · LXL04_005909 · OH-1004

Endoplasmic reticulum0.051

Rank 5 · LXL04_005909 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00462.31Glutaredoxin13-74 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_005909	`PF00462.31`	Glutaredoxin	13	74	2.7e-09	37.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O23421`	Arabidopsis thaliana	Monothiol glutaredoxin-S3	65.686%	Swiss-Prot	strong database homology
`Q6NLU2`	Arabidopsis thaliana	Monothiol glutaredoxin-S7	64.706%	Swiss-Prot	strong database homology
`O23420`	Arabidopsis thaliana	Monothiol glutaredoxin-S5	65.686%	Swiss-Prot	strong database homology
`O23419`	Arabidopsis thaliana	Monothiol glutaredoxin-S4	63.725%	Swiss-Prot	strong database homology
`Q8L8Z8`	Arabidopsis thaliana	Monothiol glutaredoxin-S2	67.647%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card