Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1032 bp · LXL04_005608|LXL04_005608|OH1004|cDNA
ATGTTGCGTATAAAAACCCCCAAATCGCTTAGAGCCAAAAGGGAGCTTGAGAAACGTGCACCAAGACTGGTGGAGTTTGGGAAAAAGACTCTCTTATTGCATGGGACAAAAACCAGCAATGTTCTTAATGCTGTATTGACAGAAATCTATCATCTTAAAAAAGACAATGCTGTGAAGTACAGCAGGAGAAATGATAACATCAGACCTTTTGAAAGTGGGGGTGAAACTTCACTTGAGTTTTACTCTCTCAAAACCGACTG...
1032 bp · LXL04_005608|LXL04_005608|OH1004|CDS
ATGTTGCGTATAAAAACCCCCAAATCGCTTAGAGCCAAAAGGGAGCTTGAGAAACGTGCACCAAGACTGGTGGAGTTTGGGAAAAAGACTCTCTTATTGCATGGGACAAAAACCAGCAATGTTCTTAATGCTGTATTGACAGAAATCTATCATCTTAAAAAAGACAATGCTGTGAAGTACAGCAGGAGAAATGATAACATCAGACCTTTTGAAAGTGGGGGTGAAACTTCACTTGAGTTTTACTCTCTCAAAACCGACTG...
Protein
Download Protein FASTA343 aa · LXL04_005608|LXL04_005608|OH1004|PROTEIN
MLRIKTPKSLRAKRELEKRAPRLVEFGKKTLLLHGTKTSNVLNAVLTEIYHLKKDNAVKYSRRNDNIRPFESGGETSLEFYSLKTDCSLFVFGSHSKKRPNNLVIGRTYDHHIYDLVELGVENFKSMASFSYDKKIAPLIGSKPFFAFIGEGFENNDELKHLKEILLDLFRGQVVKNLNLAGLDRVYVCTAVSATKVLFTHCALRLKKSGNIVPKMELVEVGPSMDLVVRRHRHPDESLRKEAMKIAPELTKKKEKNVSK...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_005608 |
|---|---|
| TK1151 ID | TkA01G028250 |
| OH-1004 ID | LXL04_005608 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 100.000 |
| Protein coverage (%) | TK1151 99.702 / OH-1004 97.668Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_005608 | ||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr01:169180536-169182556 (+) | ||||||||||||
| Description | Similar to Os01g0513800: Ribosome production factor 2 homolog | ||||||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
Rice
| ||||||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | ||||||||||||
| GO annotations (OH1004 source) | GO:0000027 ribosomal large subunit assembly Biological Process GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) Biological Process GO:0006364 rRNA processing Biological Process GO:0042273 ribosomal large subunit biogenesis Biological Process GO:1902570 protein localization to nucleolus Biological Process GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005694 chromosome Cellular Component GO:0005730 nucleolus Cellular Component GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific Molecular Function GO:0003723 RNA binding Molecular Function GO:0008097 5S rRNA binding Molecular Function | ||||||||||||
| KEGG gene cross-reference | ath:AT3G23620 bta:511294 dosa:Os01g0513800 hsa:84154 mmu:67239 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF04427.24Brix35-231 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_005608 | PF04427.24 | Brix | 35 | 231 | 2.3e-42 | 145.9 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.