LXL04_005514 | RubberDandelionOmics

Gene overview

LXL04_005514

Reference: OH-1004 Chr: Chr01 Coordinates: 166375513-166376449 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

666 bp · LXL04_005514|LXL04_005514|OH1004|cDNA

aTGCTACGATTCTTAAAATCTTTGTCGAGGACAGTGCATGAAGAGCGGTGTCATCAAGATCCACAGCCATCGAGTGGTGGTGATGATGATGGCAGCGACGGTGGCGGTGAGCCGACAAGTTTAACGGTTTGGAGGAAGTCACTGTTCGTAGGGTGCAGTGGTTTCACGGTGCTTAACTCCGGCGGTGATTTGGTGTATAGAGTTGATAACTACGGCTGCCCCCGCCGCCAAGACGTCGTGCTCATGGATGCTCCCGGTAA...

CDS

Download CDS FASTA

666 bp · LXL04_005514|LXL04_005514|OH1004|CDS

ATGCTACGATTCTTAAAATCTTTGTCGAGGACAGTGCATGAAGAGCGGTGTCATCAAGATCCACAGCCATCGAGTGGTGGTGATGATGATGGCAGCGACGGTGGCGGTGAGCCGACAAGTTTAACGGTTTGGAGGAAGTCACTGTTCGTAGGGTGCAGTGGTTTCACGGTGCTTAACTCCGGCGGTGATTTGGTGTATAGAGTTGATAACTACGGCTGCCCCCGCCGCCAAGACGTCGTGCTCATGGATGCTCCCGGTAA...

Protein

Download Protein FASTA

221 aa · LXL04_005514|LXL04_005514|OH1004|PROTEIN

MLRFLKSLSRTVHEERCHQDPQPSSGGDDDGSDGGGEPTSLTVWRKSLFVGCSGFTVLNSGGDLVYRVDNYGCPRRQDVVLMDAPGNPVLTVSRNKKVNMVDNWLVYEGEVSSKKQKPICCAKKGIDFLFLRSKAKRLAQVYRAPYDEKTGGGTYVIEGSYMNRSCKVLDESRNVLVEIRRKETTRKGVSLGLEVFVLVVNREFDSGLAMGIVLLLDQMSL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_005514`
TK1151 ID	TkA01G038480
OH-1004 ID	LXL04_005514
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_005514

Location Chr01:166375513-166376449 (+)

Description Similar to At5g41590: Protein LURP-one-related 17

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g41590`	Might be related to the phospholipid scramblase and tubby-like superfamily of membrane tethered transcription factors.	No verified direct reference in this release
`At2g38640`	Might be related to the phospholipid scramblase and tubby-like superfamily of membrane tethered transcription factors.	No verified direct reference in this release
`At1g80120`	Might be related to the phospholipid scramblase and tubby-like superfamily of membrane tethered transcription factors.	No verified direct reference in this release
`At3g15810`	Might be related to the phospholipid scramblase and tubby-like superfamily of membrane tethered transcription factors.	No verified direct reference in this release
`At3g14260`	Might be related to the phospholipid scramblase and tubby-like superfamily of membrane tethered transcription factors.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005514 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

KEGG gene cross-reference

ath:AT1G80120

ath:AT2G38640

ath:AT3G14260

ath:AT3G15810

ath:AT5G41590

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.478

Rank 1 · LXL04_005514 · OH-1004

Nucleus0.432

Rank 2 · LXL04_005514 · OH-1004

Cell membrane0.251

Rank 3 · LXL04_005514 · OH-1004

Endoplasmic reticulum0.089

Rank 4 · LXL04_005514 · OH-1004

Lysosome / Vacuole0.047

Rank 5 · LXL04_005514 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04525.20LOR39-217 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_005514	`PF04525.20`	LOR	39	217	4.4e-27	96.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`A0MFL4`	Arabidopsis thaliana	Protein LURP-one-related 17	45.536%	Swiss-Prot	moderate database homology
`Q9ZVI6`	Arabidopsis thaliana	Protein LURP-one-related 8	46.154%	Swiss-Prot	moderate database homology
`Q9SSC7`	Arabidopsis thaliana	Protein LURP-one-related 5	40.957%	Swiss-Prot	moderate database homology
`Q9LVZ8`	Arabidopsis thaliana	Protein LURP-one-related 12	34.946%	Swiss-Prot	moderate database homology
`Q9LUM1`	Arabidopsis thaliana	Protein LURP-one-related 11	27.094%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card