LXL04_005461 | RubberDandelionOmics

Gene overview

LXL04_005461

Reference: OH-1004 Chr: Chr01 Coordinates: 164589493-164590993 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1104 bp · LXL04_005461|LXL04_005461|OH1004|cDNA

ATGGATCGTCAATGTCGCCGCCTTGATCGCCATCGTCGCCGGAGACAATCTTCTTCCCCGTCATCGGATAGAAAAACAACAGCCTTGCTGACGTCCTCTTCCTCCGTCCACCACCTCATGTTGTTTATCTTATGTGTCGTTAATACTAATCCTATAAATTCCGCCATCGCTTTTGATTTGAACACCATAACCTTCGATCAAGGCTACGCAACTCTCTTCAGCGACTTCAATATCGATCGATCCGATGACGACCAGAGCGT...

CDS

Download CDS FASTA

1104 bp · LXL04_005461|LXL04_005461|OH1004|CDS

ATGGATCGTCAATGTCGCCGCCTTGATCGCCATCGTCGCCGGAGACAATCTTCTTCCCCGTCATCGGATAGAAAAACAACAGCCTTGCTGACGTCCTCTTCCTCCGTCCACCACCTCATGTTGTTTATCTTATGTGTCGTTAATACTAATCCTATAAATTCCGCCATCGCTTTTGATTTGAACACCATAACCTTCGATCAAGGCTACGCAACTCTCTTCAGCGACTTCAATATCGATCGATCCGATGACGACCAGAGCGT...

Protein

Download Protein FASTA

367 aa · LXL04_005461|LXL04_005461|OH1004|PROTEIN

MDRQCRRLDRHRRRRQSSSPSSDRKTTALLTSSSSVHHLMLFILCVVNTNPINSAIAFDLNTITFDQGYATLFSDFNIDRSDDDQSVRLILNRQSGSGIISTDYYNYGFFSAKIKLPTKYTAGIVVAFYTSNIDMFSKTHDELDLEFLGNVRGKPWRFQTNFYGNGSTIRGREERYRLWFDPSKEFHRYSILWARNKIIFYVDEIPIREVLRDDNMGGDYPSKPMSSYATVWDASSWATNGGRNKVDYRFEPFAAEFRDL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_005461`
TK1151 ID	TkA03G453050
OH-1004 ID	LXL04_005461
Relationship / confidence	Rbh High Identity Coverage Local Synteny Minor Chr Pair / Probable
Protein identity (%)	99.400
Protein coverage (%)	TK1151 100.000 / OH-1004 89.373 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_005461

Location Chr01:164589493-164590993 (-)

Description Similar to XTH30: Probable xyloglucan endotransglucosylase/hydrolase protein 30

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g32170`	Catalyzes xyloglucan endohydrolysis (XEH) and/or endotransglycosylation (XET).	No verified direct reference in this release
`At4g18990`	Catalyzes xyloglucan endohydrolysis (XEH) and/or endotransglycosylation (XET).	No verified direct reference in this release
`At2g01850`	Catalyzes xyloglucan endohydrolysis (XEH) and/or endotransglycosylation (XET).	AtXTH27 plays an essential role in cell wall modification during the development of tracheary elements.2005 · DOI: 10.1111/j.1365-313x.2005.02395.x
`At1g14720`	Catalyzes xyloglucan endohydrolysis (XEH) and/or endotransglycosylation (XET).	No verified direct reference in this release
`At1g10550`	Catalyzes xyloglucan endohydrolysis (XEH) and/or endotransglycosylation (XET).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005461 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009831 plant-type cell wall modification involved in multidimensional cell growth Biological Process

GO:0010087 phloem or xylem histogenesis Biological Process

GO:0010154 fruit development Biological Process

GO:0010411 xyloglucan metabolic process Biological Process

GO:0042546 cell wall biogenesis Biological Process

GO:0071555 cell wall organization Biological Process

GO:0080086 stamen filament development Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0048046 apoplast Cellular Component

GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Molecular Function

GO:0016762 xyloglucan:xyloglucosyl transferase activity Molecular Function

KEGG gene cross-reference

ath:AT1G10550

ath:AT1G14720

ath:AT1G32170

ath:AT2G01850

ath:AT4G18990

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.294

Rank 1 · LXL04_005461 · OH-1004

Cell membrane0.154

Rank 2 · LXL04_005461 · OH-1004

Extracellular0.143

Rank 3 · LXL04_005461 · OH-1004

Endoplasmic reticulum0.094

Rank 4 · LXL04_005461 · OH-1004

Cytoplasm0.057

Rank 5 · LXL04_005461 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00722.29Glyco_hydro_1667-249 aa

PF06955.20XET_C290-326 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_005461	`PF00722.29`	Glyco_hydro_16	67	249	2.2e-54	184.3
LXL04_005461	`PF06955.20`	XET_C	290	326	1.9e-14	53.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q38908`	Arabidopsis thaliana	Probable xyloglucan endotransglucosylase/hydrolase protein 30	61.342%	Swiss-Prot	strong database homology
`Q8L7H3`	Arabidopsis thaliana	Probable xyloglucan endotransglucosylase/hydrolase protein 29	59.797%	Swiss-Prot	strong database homology
`Q8LDS2`	Arabidopsis thaliana	Probable xyloglucan endotransglucosylase/hydrolase protein 27	49.689%	Swiss-Prot	moderate database homology
`Q38909`	Arabidopsis thaliana	Probable xyloglucan endotransglucosylase/hydrolase protein 28	53.846%	Swiss-Prot	strong database homology
`Q8LC45`	Arabidopsis thaliana	Probable xyloglucan endotransglucosylase/hydrolase protein 33	38.944%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card