LXL04_005322 | RubberDandelionOmics

Gene overview

LXL04_005322

Reference: OH-1004 Chr: Chr01 Coordinates: 160377099-160382902 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

822 bp · LXL04_005322|LXL04_005322|OH1004|cDNA

ATGACTTCTATCAAAAGACACTCTCAAATCGGTGACACCGTCCGATCACGAAAACCCCCAAACTCACACAAACCCCAAAACATGGTGGTCCCAGTCATGGGCCTAGACAGAGACAACAACCGAATCCCTCACGTTCTTGTCAGTGTCCACGACATTCACGACCAAGTCCGGAGTTCTATCGAATATGGTCTTACTCCCGTTAAATTGGGGGTTTGTGTTGGCACCAAAATGATTGTGAAGAAAAATGAAAGCTCAGAAAG...

CDS

Download CDS FASTA

822 bp · LXL04_005322|LXL04_005322|OH1004|CDS

ATGACTTCTATCAAAAGACACTCTCAAATCGGTGACACCGTCCGATCACGAAAACCCCCAAACTCACACAAACCCCAAAACATGGTGGTCCCAGTCATGGGCCTAGACAGAGACAACAACCGAATCCCTCACGTTCTTGTCAGTGTCCACGACATTCACGACCAAGTCCGGAGTTCTATCGAATATGGTCTTACTCCCGTTAAATTGGGGGTTTGTGTTGGCACCAAAATGATTGTGAAGAAAAATGAAAGCTCAGAAAG...

Protein

Download Protein FASTA

273 aa · LXL04_005322|LXL04_005322|OH1004|PROTEIN

MTSIKRHSQIGDTVRSRKPPNSHKPQNMVVPVMGLDRDNNRIPHVLVSVHDIHDQVRSSIEYGLTPVKLGVCVGTKMIVKKNESSESGDIRNAMWLPPNPGGTVLPHALTNTLSEIGTLRLIPNTLALMAVQRQAATSKSTKPSSNAQHLLDSWDPITTFTNPKTSAHTPSFKVSLGQEGFAGGALGGGIGFVGVHVPQASENETLQMMRKKMKILHASERAVGGDGGSDYGKGRSGGGDDNDVNSDDGGGGGRHNHILI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_005322`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_005322

Location Chr01:160377099-160382902 (+)

Description Protein of unknown function

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g32250`	Serine/threonine protein kinase acting as a regulatory component of the plastid protein import machinery by phosphorylating import receptors (e.g. the A-domain of TOC159, TOC120 and TOC132).	The novel chloroplast outer membrane kinase KOC1 is a required component of the plastid protein import machinery.2017 · DOI: 10.1074/jbc.m117.776468

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005322 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009704 de-etiolation Biological Process

GO:0045036 protein targeting to chloroplast Biological Process

GO:1904216 positive regulation of protein import into chloroplast stroma Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0009707 chloroplast outer membrane Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0010006 Toc complex Cellular Component

GO:0004672 protein kinase activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT4G32250

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.596

Rank 1 · LXL04_005322 · OH-1004

Cytoplasm0.302

Rank 2 · LXL04_005322 · OH-1004

Mitochondrion0.070

Rank 3 · LXL04_005322 · OH-1004

Cell membrane0.051

Rank 4 · LXL04_005322 · OH-1004

Endoplasmic reticulum0.031

Rank 5 · LXL04_005322 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8RWX4`	Arabidopsis thaliana	Protein KINASE OF THE OUTER CHLOROPLAST MEMBRANE 1	54.386%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card