LXL04_005157 | RubberDandelionOmics

Gene overview

LXL04_005157

Reference: OH-1004 Chr: Chr01 Coordinates: 156732958-156736175 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1419 bp · LXL04_005157|LXL04_005157|OH1004|cDNA

ATGTTAAGCATCCAATTAATGATCACTTCCCACATTCTGTACCAAATAGGAAACCAAAATCAAATACAATGGTTAAGAACTCACTCCATTTCTTTTCCTCACGCTTTTTCCACTGATGCAGATCGTGGAGATGTGCAAAAGGGAAGCGCAGAGATATTTTTCCGCAAAGTAAAGTTCTGGAAAGAAGATGGTGAAACTGAAGCTCCACCTGTCTTTAATGTTGATGGTGTCAACTACTTTCATGTAAAAGTTGTTGGATT...

CDS

Download CDS FASTA

1419 bp · LXL04_005157|LXL04_005157|OH1004|CDS

ATGTTAAGCATCCAATTAATGATCACTTCCCACATTCTGTACCAAATAGGAAACCAAAATCAAATACAATGGTTAAGAACTCACTCCATTTCTTTTCCTCACGCTTTTTCCACTGATGCAGATCGTGGAGATGTGCAAAAGGGAAGCGCAGAGATATTTTTCCGCAAAGTAAAGTTCTGGAAAGAAGATGGTGAAACTGAAGCTCCACCTGTCTTTAATGTTGATGGTGTCAACTACTTTCATGTAAAAGTTGTTGGATT...

Protein

Download Protein FASTA

472 aa · LXL04_005157|LXL04_005157|OH1004|PROTEIN

MLSIQLMITSHILYQIGNQNQIQWLRTHSISFPHAFSTDADRGDVQKGSAEIFFRKVKFWKEDGETEAPPVFNVDGVNYFHVKVVGLLFVATTRANISPSLVLELLQRIARVTKDYLGILNEDSIRKNFVLVYELLDEVIDFGYVQTTSTEVLKSSVFNEPIMVDSAHMPPLGPAALFMQGNKRMPGTAVTKSVVANEPGGRKREEIFVDIIEKISVTFSSSGYILTSEIDGTIQMKSYLSGNPEIRLALNEDLNIGRGG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_005157`
TK1151 ID	TkA01G079320
OH-1004 ID	LXL04_005157
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	97.000
Protein coverage (%)	TK1151 98.039 / OH-1004 41.737 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_005157

Location Chr01:156732958-156736175 (-)

Description Similar to AP4M: AP-4 complex subunit mu

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g24550`	Subunit of novel type of clathrin- or non-clathrin-associated protein coat involved in targeting proteins from the trans-Golgi network (TGN) to the endosomal-lysosomal system.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005157 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000045 autophagosome assembly Biological Process

GO:0006605 protein targeting Biological Process

GO:0006622 protein targeting to lysosome Biological Process

GO:0006886 intracellular protein transport Biological Process

GO:0006892 post-Golgi vesicle-mediated transport Biological Process

GO:0006895 Golgi to endosome transport Biological Process

GO:0008104 intracellular protein localization Biological Process

GO:0016192 vesicle-mediated transport Biological Process

GO:0090160 Golgi to lysosome transport Biological Process

GO:1903361 protein localization to basolateral plasma membrane Biological Process

GO:0005769 early endosome Cellular Component

GO:0005802 trans-Golgi network Cellular Component

KEGG gene cross-reference

ath:AT4G24550

bta:768040

hsa:9179

mmu:11781

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.518

Rank 1 · LXL04_005157 · OH-1004

Golgi apparatus0.455

Rank 2 · LXL04_005157 · OH-1004

Lysosome / Vacuole0.164

Rank 3 · LXL04_005157 · OH-1004

Cell membrane0.137

Rank 4 · LXL04_005157 · OH-1004

Nucleus0.131

Rank 5 · LXL04_005157 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00928.27Adap_comp_sub203-472 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_005157	`PF00928.27`	Adap_comp_sub	203	472	2.4e-79	267.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SB50`	Arabidopsis thaliana	AP-4 complex subunit mu	85.383%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card