LXL04_004011 | RubberDandelionOmics

Gene overview

LXL04_004011

Reference: OH-1004 Chr: Chr01 Coordinates: 121798444-121806517 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

6446 bp · LXL04_004011|LXL04_004011|OH1004|cDNA

ATGTAGTTCATAAAACACCCAAAAATTTGAGTGTTGAGATGAAGTTAAAACTAGAGCTTCTAAGTGGTGATGTGGAAACTGGATTTATAGATGGTAATGCAGTTGATGGGCATACATGGATGTTCATTAAGATCTGGAAGGACACATGTGAAAAAAAGAGCATACCTGAGGCATTTGGCAAGATGATTGACTTTTATAAGGGTCCAACAAAGCCAAAGAAGAAAACCAAAGACCTAAATAAAGTTATGGTACCTCCATAT...

CDS

Download CDS FASTA

6420 bp · LXL04_004011|LXL04_004011|OH1004|CDS

TTGAGTGTTGAGATGAAGTTAAAACTAGAGCTTCTAAGTGGTGATGTGGAAACTGGATTTATAGATGGTAATGCAGTTGATGGGCATACATGGATGTTCATTAAGATCTGGAAGGACACATGTGAAAAAAAGAGCATACCTGAGGCATTTGGCAAGATGATTGACTTTTATAAGGGTCCAACAAAGCCAAAGAAGAAAACCAAAGACCTAAATAAAGTTATGGTACCTCCATATGTTGGATTGCTTAAAGTTGCAATTGC...

Protein

Download Protein FASTA

2139 aa · LXL04_004011|LXL04_004011|OH1004|PROTEIN

MSVEMKLKLELLSGDVETGFIDGNAVDGHTWMFIKIWKDTCEKKSIPEAFGKMIDFYKGPTKPKKKTKDLNKVMVPPYVGLLKVAIASMKFGFWDCMSSAPQANNKEAAFYEHSRMDDDPFDVNTWMFIKIWKDTCQKENVFEAFGKMLDFYYGGKKKTKALKSMTLSYPYVGLVNVAIASIKFGMWDHKISTFQENTKEVLAYTNSIMCALDVNTEEKDVLEGCVCIALEDVVKYIKADFVFPDHVLDDVNSFPKKQFI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_004011`
TK1151 ID	TkA01G214450
OH-1004 ID	LXL04_004011
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	99.400
Protein coverage (%)	TK1151 100.000 / OH-1004 95.886 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_004011

Location Chr01:121798444-121806517 (-)

Description Similar to NOV: Protein NO VEIN

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g13750`	Essential protein required for cell fate determination during embryogenesis.	No verified direct reference in this release
`At1g08300`	Protein NO VEIN-LIKE.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004011 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0001708 cell fate specification Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0009926 auxin polar transport Biological Process

GO:0010305 leaf vascular tissue pattern formation Biological Process

GO:0019827 stem cell population maintenance Biological Process

GO:0048364 root development Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT1G08300

ath:AT4G13750

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.666

Rank 1 · LXL04_004011 · OH-1004

Cytoplasm0.313

Rank 2 · LXL04_004011 · OH-1004

Cell membrane0.067

Rank 3 · LXL04_004011 · OH-1004

Endoplasmic reticulum0.046

Rank 4 · LXL04_004011 · OH-1004

Golgi apparatus0.031

Rank 5 · LXL04_004011 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25794.2SACS709-803 aa

PF13020.13NOV_C2019-2105 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_004011	`PF25794.2`	SACS	709	803	2.8e-11	44.4
LXL04_004011	`PF13020.13`	NOV_C	2019	2105	1.9e-20	73.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4JTS8`	Arabidopsis thaliana	Protein NO VEIN	43.628%	Swiss-Prot	moderate database homology
`A0A1P8ARG1`	Arabidopsis thaliana	Protein NO VEIN-LIKE	46.763%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card