LXL04_004001 | RubberDandelionOmics

Gene overview

LXL04_004001

Reference: OH-1004 Chr: Chr01 Coordinates: 121304802-121308264 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2069 bp · LXL04_004001|LXL04_004001|OH1004|cDNA

AAGTTTCTTACAAATCAATCGTTGGTACGGCAACAAGCCAACAACCTCGATTTTAATATGAAGGAACGAGTGTAATTTTGCCATTTGTTTCTCCCAGTTTCCCTAATACTGGCTTTGCTCACTCTATAGCCTATCACCTCAACCACGTCCAGCCGTCTCCACGCCGCCGCCATCACCTCCGTTGACTACCGAACACTTCCACCATGCAAGCTTCCTTGATTGCCCCAACTCCCCGCCCCACCAGCATTCTCCCATCCCCA...

CDS

Download CDS FASTA

1866 bp · LXL04_004001|LXL04_004001|OH1004|CDS

ATGCAAGCTTCCTTGATTGCCCCAACTCCCCGCCCCACCAGCATTCTCCCATCCCCAACTTTCCGACCGCTCATCTCTACCAACCATAAACCCTACACACTCTCACTCCGAGCCTCCGCCGTCTCCTCATCCACTACCGAAACAGTCCCACCACCACCGCAAACTGTATCCTCCACTGACCCATCATCAAAACTCAACAAATTCAGCTCCAGAATCACCGAACCCAAGTCACAGGGTGGCTCTCAGGCCGTACTTTACGG...

Protein

Download Protein FASTA

621 aa · LXL04_004001|LXL04_004001|OH1004|PROTEIN

MQASLIAPTPRPTSILPSPTFRPLISTNHKPYTLSLRASAVSSSTTETVPPPPQTVSSTDPSSKLNKFSSRITEPKSQGGSQAVLYGVGLSDDDLKKPQIGISSVWYEGNTCNMHLLKLAEAVKEGVQDAGLIGFRFNTIGVSDAISMGTRGMCYSLQSRDLIADSIETVMSAQWYDANISIPGCDKNMPGTIMAMGRLNRPSIMIYGGTIKPGHFNGHTYDIVSAFQVYGEYVSGSISDEHRTDVLRASCPGAGACGGM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_004001`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_004001

Location Chr01:121304802-121308264 (-)

Description Similar to DHAD: Dihydroxy-acid dehydratase, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g23940`	Functions in the biosynthesis of branched-chain amino acids.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004001 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009082 branched-chain amino acid biosynthetic process Biological Process

GO:0009097 isoleucine biosynthetic process Biological Process

GO:0009099 L-valine biosynthetic process Biological Process

GO:0009553 embryo sac development Biological Process

GO:0009555 pollen development Biological Process

GO:0009651 response to salt stress Biological Process

GO:0048364 root development Biological Process

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0000287 magnesium ion binding Molecular Function

GO:0004160 dihydroxy-acid dehydratase activity Molecular Function

KEGG gene cross-reference

ath:AT3G23940

fph:Fphi_1547

ftm:FTM_1218

ftw:FTW_1090

rba:RB12087

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.851

Rank 1 · LXL04_004001 · OH-1004

Mitochondrion0.194

Rank 2 · LXL04_004001 · OH-1004

Cytoplasm0.041

Rank 3 · LXL04_004001 · OH-1004

Peroxisome0.027

Rank 4 · LXL04_004001 · OH-1004

Cell membrane0.017

Rank 5 · LXL04_004001 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00920.28ILVD_EDD_N97-414 aa

PF24877.2ILV_EDD_C426-616 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_004001	`PF00920.28`	ILVD_EDD_N	97	414	1.4e-130	435.8
LXL04_004001	`PF24877.2`	ILV_EDD_C	426	616	3.1e-73	246.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LIR4`	Arabidopsis thaliana	Dihydroxy-acid dehydratase, chloroplastic	79.227%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card