LXL04_003726 | RubberDandelionOmics

Gene overview

LXL04_003726

Reference: OH-1004 Chr: Chr01 Coordinates: 97893517-97895920 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1026 bp · LXL04_003726|LXL04_003726|OH1004|cDNA

ATGTCAACAGATGCATGTTTAGTTGTTGATGCACTTGAGCCATCAGTGAGGGAAGAGTTGGTGAAAAACTTTTGTGACAGGGAACTTATTTCATATCAGCAGATATTTGAAGGAGCTGGTCACAACTTGAGAAAGCAGGGGCAAGCAGGCGACAAAACAGCAGCCACTAGAGCAGCCAACAACACCGGGGTGAGCCTAGAAAGCAGCCGGACCAACAGGGGCAAAATCGTCCGAAAAAACAGCATCAAAGAACGGCACCA...

CDS

Download CDS FASTA

1026 bp · LXL04_003726|LXL04_003726|OH1004|CDS

ATGTCAACAGATGCATGTTTAGTTGTTGATGCACTTGAGCCATCAGTGAGGGAAGAGTTGGTGAAAAACTTTTGTGACAGGGAACTTATTTCATATCAGCAGATATTTGAAGGAGCTGGTCACAACTTGAGAAAGCAGGGGCAAGCAGGCGACAAAACAGCAGCCACTAGAGCAGCCAACAACACCGGGGTGAGCCTAGAAAGCAGCCGGACCAACAGGGGCAAAATCGTCCGAAAAAACAGCATCAAAGAACGGCACCA...

Protein

Download Protein FASTA

341 aa · LXL04_003726|LXL04_003726|OH1004|PROTEIN

MSTDACLVVDALEPSVREELVKNFCDRELISYQQIFEGAGHNLRKQGQAGDKTAATRAANNTGVSLESSRTNRGKIVRKNSIKERHQGSTEANKTAGSRASKNSWDNLEISLTNRGKNIELLNPQLHCIYHLSLPIVNYLVWSRDYWSMQSEKRPVRVWPGGLYLIRSCRHPTLKWAQRDDLVYITIDLPDAKNVNLKLTQEGKFYFSAISGPDSTPYEIDINLYDNGNVDESKANVGSRNVVYIVKKEESKWWNRLMKQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_003726`
TK1151 ID	TkA01G371100
OH-1004 ID	LXL04_003726
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	93.800
Protein coverage (%)	TK1151 100.000 / OH-1004 56.598 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_003726

Location Chr01:97893517-97895920 (-)

Description Similar to P23-1: Co-chaperone protein p23-1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g03773`	Acts as a co-chaperone for HSP90.	Characterization of plant p23-like proteins for their co-chaperone activities.2010 · DOI: 10.1007/s12192-010-0182-1
`At4g02450`	Acts as a co-chaperone for HSP90.	Characterization of plant p23-like proteins for their co-chaperone activities.2010 · DOI: 10.1007/s12192-010-0182-1

Rice

Reference gene ID	Possible function	Papers / DOI
`Os08g0359500`	Uncharacterized protein Os08g0359500.	No verified direct reference in this release
`UniProt: P0C8Z0`	Uncharacterized protein OsI_027940.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003726 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006457 protein folding Biological Process

GO:0006950 response to stress Biological Process

GO:0009408 response to heat Biological Process

GO:0010449 root meristem growth Biological Process

GO:0010628 positive regulation of gene expression Biological Process

GO:0051131 chaperone-mediated protein complex assembly Biological Process

GO:0080037 negative regulation of cytokinin-activated signaling pathway Biological Process

GO:2000012 regulation of auxin polar transport Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT3G03773

ath:AT4G02450

dosa:Os08g0359500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.491

Rank 1 · LXL04_003726 · OH-1004

Nucleus0.360

Rank 2 · LXL04_003726 · OH-1004

Mitochondrion0.115

Rank 3 · LXL04_003726 · OH-1004

Cell membrane0.102

Rank 4 · LXL04_003726 · OH-1004

Endoplasmic reticulum0.090

Rank 5 · LXL04_003726 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04100.19Vps53_N3-37 aa

PF04969.23CS173-248 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_003726	`PF04100.19`	Vps53_N	3	37	1.1e-08	35.2
LXL04_003726	`PF04969.23`	CS	173	248	5.6e-08	34.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6ID70`	Arabidopsis thaliana	Co-chaperone protein p23-2	45.536%	Swiss-Prot	weak database homology
`Q8L7U4`	Arabidopsis thaliana	Co-chaperone protein p23-1	40.984%	Swiss-Prot	weak database homology
`Q6YYB0`	Oryza sativa subsp. japonica	Uncharacterized protein Os08g0359500	48.462%	Swiss-Prot	weak database homology
`P0C8Z0`	Oryza sativa subsp. indica	Uncharacterized protein OsI_027940	48.462%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card