LXL04_000788 | RubberDandelionOmics

Gene overview

LXL04_000788

Reference: OH-1004 Chr: Chr01 Coordinates: 14403404-14405699 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

807 bp · LXL04_000788|LXL04_000788|OH1004|cDNA

ATGGCGAAGGGCGTGTGTTCGGCGGCCGTGCAAGCAGAACAACTTAAGCAAGACGGAAACCTGTATTTCAAAAAGAATAGGTTGGGAGCCGCCATCGATGCTTATACCGAGGCCATCACTTTGTGCCCTGATGTTCCGGTTTATTGGACCAATCGGGCTTTATGCCATCGCAAGCGCAATGATTGGACAAGAGTTGAAGAGGACTGTCGGAAGGCTGTTCAGCTTGATCATAAATCTGTCAAGGGTCACTACATGCTAGG...

CDS

Download CDS FASTA

807 bp · LXL04_000788|LXL04_000788|OH1004|CDS

ATGGCGAAGGGCGTGTGTTCGGCGGCCGTGCAAGCAGAACAACTTAAGCAAGACGGAAACCTGTATTTCAAAAAGAATAGGTTGGGAGCCGCCATCGATGCTTATACCGAGGCCATCACTTTGTGCCCTGATGTTCCGGTTTATTGGACCAATCGGGCTTTATGCCATCGCAAGCGCAATGATTGGACAAGAGTTGAAGAGGACTGTCGGAAGGCTGTTCAGCTTGATCATAAATCTGTCAAGGGTCACTACATGCTAGG...

Protein

Download Protein FASTA

268 aa · LXL04_000788|LXL04_000788|OH1004|PROTEIN

MAKGVCSAAVQAEQLKQDGNLYFKKNRLGAAIDAYTEAITLCPDVPVYWTNRALCHRKRNDWTRVEEDCRKAVQLDHKSVKGHYMLGLALIERENYSEGIKSLERALDHGRGAHPNSYMVEEIWQELAKAKYQEWERHSTKRNWDLHKLQESCEMALKEHHVDGDVDVNEQLEALKLVFEKAAEADVPTEVPDYLCCKITLDIFRDPVITPSGLTYERAVILDHLEKVGKFDPITRESLVQSQLVPNMAIKEAVGAFLEK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_000788`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_000788

Location Chr01:14403404-14405699 (+)

Description Similar to CHIP: E3 ubiquitin-protein ligase CHIP

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g07370`	Has E3 ubiquitin-protein ligase activity and may target misfolded substrates towards proteasomal degradation.	AtCHIP, a U-box-containing E3 ubiquitin ligase, plays a critical role in temperature stress tolerance in Arabidopsis.2003 · DOI: 10.1104/pp.103.020800 AtCHIP functions as an E3 ubiquitin ligase of protein phosphatase 2A subunits and alters plant response to abscisic acid treatment.2006 · DOI: 10.1111/j.1365-313x.2006.02730.x The chloroplast protease subunit ClpP4 is a substrate of the E3 ligase AtCHIP and plays an important role in chloroplast function.2007 · DOI: 10.1111/j.1365-313x.2006.02963.x The E3 ligase AtCHIP ubiquitylates FtsH1, a component of the chloroplast FtsH protease, and affects protein degradation in chloroplasts.2007 · DOI: 10.1111/j.1365-313x.2007.03239.x Heat shock protein cognate 70-4 and an E3 ubiquitin ligase, CHIP, mediate plastid-destined precursor degradation through the ubiquitin-26S proteasome system in Arabidopsis.2009 · DOI: 10.1105/tpc.109.071548

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000788 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000165 MAPK cascade Biological Process

GO:0000209 protein polyubiquitination Biological Process

GO:0002931 response to ischemia Biological Process

GO:0006281 DNA repair Biological Process

GO:0006457 protein folding Biological Process

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0006513 protein monoubiquitination Biological Process

GO:0006515 protein quality control for misfolded or incompletely synthesized proteins Biological Process

GO:0007165 signal transduction Biological Process

GO:0009266 response to temperature stimulus Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

KEGG gene cross-reference

ath:AT3G07370

gga:426918

hsa:10273

mmu:56424

rno:287155

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.562

Rank 1 · LXL04_000788 · OH-1004

Nucleus0.446

Rank 2 · LXL04_000788 · OH-1004

Mitochondrion0.138

Rank 3 · LXL04_000788 · OH-1004

Cell membrane0.054

Rank 4 · LXL04_000788 · OH-1004

Golgi apparatus0.046

Rank 5 · LXL04_000788 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00515.35TPR_112-44 aa

PF13414.13TPR_1119-54 aa

PF12895.14ANAPC347-106 aa

PF00515.35TPR_148-78 aa

PF04564.22U-box191-263 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_000788	`PF00515.35`	TPR_1	12	44	4.1e-19	68.2
LXL04_000788	`PF13414.13`	TPR_11	19	54	4.1e-11	43.1
LXL04_000788	`PF12895.14`	ANAPC3	47	106	3.6e-07	31.1
LXL04_000788	`PF00515.35`	TPR_1	48	78	4.1e-19	68.2
LXL04_000788	`PF04564.22`	U-box	191	263	1.1e-26	93.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SRS9`	Arabidopsis thaliana	E3 ubiquitin-protein ligase CHIP	63.669%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card