LXL04_000759 | RubberDandelionOmics

Gene overview

LXL04_000759

Reference: OH-1004 Chr: Chr01 Coordinates: 13976408-13978672 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1296 bp · LXL04_000759|LXL04_000759|OH1004|cDNA

ATGTCTGATTACGAAATACCTTTCCACATTCAAGAAAACATCATGAAAAGGCTTCCGGTGAAATCGCTGGTTCAGTTCAGAAGCGTCTCAAAATCATGGAAATCTCTGATCGACAGCTCCGAGTTTATAGCTTCTCATAGCCTCCGCCGCCGCACTCATCCACAACATATGCTTGTAACATACGTAAGTCAAGGGGACAAATACTATATCTGTTTTCTCGATGATGACACCTACCCCCAACAGAGGTTTGTTCCGACTTT...

CDS

Download CDS FASTA

1296 bp · LXL04_000759|LXL04_000759|OH1004|CDS

ATGTCTGATTACGAAATACCTTTCCACATTCAAGAAAACATCATGAAAAGGCTTCCGGTGAAATCGCTGGTTCAGTTCAGAAGCGTCTCAAAATCATGGAAATCTCTGATCGACAGCTCCGAGTTTATAGCTTCTCATAGCCTCCGCCGCCGCACTCATCCACAACATATGCTTGTAACATACGTAAGTCAAGGGGACAAATACTATATCTGTTTTCTCGATGATGACACCTACCCCCAACAGAGGTTTGTTCCGACTTT...

Protein

Download Protein FASTA

431 aa · LXL04_000759|LXL04_000759|OH1004|PROTEIN

MSDYEIPFHIQENIMKRLPVKSLVQFRSVSKSWKSLIDSSEFIASHSLRRRTHPQHMLVTYVSQGDKYYICFLDDDTYPQQRFVPTFPLSPEHIFHIGSSHGLFGLYYSLDHNFTTKSVILWNPFIRKSIVVPVPNKSYVGFGVCPVTSDPKIVSVTQSWDEPRTETSYHCEVMVYTLSSGKWKTVSDNLPTKPLEVSRSTIVTNRFIYWRADSWTGNSWSDNMMISFDATNEKFEMIELPDSLAHHDPKYMYVSMVRDS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_000759`
TK1151 ID	TkA01G589970
OH-1004 ID	LXL04_000759
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 95.111 / OH-1004 49.652 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_000759

Location Chr01:13976408-13978672 (-)

Description Similar to At1g47790: Putative F-box protein At1g47790

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g47790`	Putative F-box protein At1g47790.	No verified direct reference in this release
`At1g50870`	Putative F-box protein At1g50870.	No verified direct reference in this release
`At4g12560`	Component of SCF(ASK-cullin-F-box) E3 ubiquitin ligase complexes, which may mediate the ubiquitination and subsequent proteasomal degradation of target proteins (By similarity).	An F-box gene, CPR30, functions as a negative regulator of the defense response in Arabidopsis.2009 · DOI: 10.1111/j.1365-313x.2009.03995.x
`At1g47730`	Putative F-box protein At1g47730.	No verified direct reference in this release
`At2g21930`	F-box protein At2g21930.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000759 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009626 plant-type hypersensitive response Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0031348 negative regulation of defense response Biological Process

GO:0042177 negative regulation of protein catabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT1G47730

ath:AT1G47790

ath:AT1G50870

ath:AT2G21930

ath:AT4G12560

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.600

Rank 1 · LXL04_000759 · OH-1004

Nucleus0.400

Rank 2 · LXL04_000759 · OH-1004

Cell membrane0.132

Rank 3 · LXL04_000759 · OH-1004

Endoplasmic reticulum0.076

Rank 4 · LXL04_000759 · OH-1004

Lysosome / Vacuole0.041

Rank 5 · LXL04_000759 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00646.39F-box6-42 aa

PF08268.18FBA_372-283 aa

PF07734.19FBA_1111-279 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_000759	`PF00646.39`	F-box	6	42	5.1e-11	42.7
LXL04_000759	`PF08268.18`	FBA_3	72	283	3.4e-15	56.6
LXL04_000759	`PF07734.19`	FBA_1	111	279	6.8e-12	45.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FZF8`	Arabidopsis thaliana	Putative F-box protein At1g47790	27.823%	Swiss-Prot	weak database homology
`Q9C6J3`	Arabidopsis thaliana	Putative F-box protein At1g50870	24.054%	Swiss-Prot	weak database homology
`Q9SU30`	Arabidopsis thaliana	F-box protein CPR1	26.426%	Swiss-Prot	weak database homology
`Q9SXA0`	Arabidopsis thaliana	Putative F-box protein At1g47730	26.710%	Swiss-Prot	weak database homology
`Q9SJ06`	Arabidopsis thaliana	F-box protein At2g21930	26.749%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card