LXL04_000753 | RubberDandelionOmics

Gene overview

LXL04_000753

Reference: OH-1004 Chr: Chr01 Coordinates: 13930499-13933488 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1488 bp · LXL04_000753|LXL04_000753|OH1004|cDNA

ATGGCGGGTGGTGAAGGAGAAGGGACGTCGTTAGAATTTACACCCACATGGGTTGTCGCCGCCGTGTGTACCCTCATCGTCGGAATCTCCCTCGCCGTCGAACGTCTACTCCATTACGCCGGCAAGAAATTGAAGAAGGCAGGTCAAAAGCCACTTTATGAAGCCCTTCAAAAGATCAAAGAAGAGCTGATGCTGTTGGGGTTTATTTCGCTTCTATTGACGGTGTTCCAGTCTAGAATCATCAGAATATGCGTAAAGCA...

CDS

Download CDS FASTA

1488 bp · LXL04_000753|LXL04_000753|OH1004|CDS

ATGGCGGGTGGTGAAGGAGAAGGGACGTCGTTAGAATTTACACCCACATGGGTTGTCGCCGCCGTGTGTACCCTCATCGTCGGAATCTCCCTCGCCGTCGAACGTCTACTCCATTACGCCGGCAAGAAATTGAAGAAGGCAGGTCAAAAGCCACTTTATGAAGCCCTTCAAAAGATCAAAGAAGAGCTGATGCTGTTGGGGTTTATTTCGCTTCTATTGACGGTGTTCCAGTCTAGAATCATCAGAATATGCGTAAAGCA...

Protein

Download Protein FASTA

495 aa · LXL04_000753|LXL04_000753|OH1004|PROTEIN

MAGGEGEGTSLEFTPTWVVAAVCTLIVGISLAVERLLHYAGKKLKKAGQKPLYEALQKIKEELMLLGFISLLLTVFQSRIIRICVKQSIMNHLLPCSLGDREKAIGPKPESEITSHLLRHLLAEEESSTGYCAKKGKVPLLSLEALHHLHIFIFVLAVVHVTFSVLTVVFGSGRIRQWKHWEDSIAKDNFDASKVFKPRVTHVKDHDFIRNRFVGIGKGSAIRGWLHSFFKQFYGSVTKSDYVALRLGFITTHCKANPKF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_000753`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_000753

Location Chr01:13930499-13933488 (+)

Description Similar to MLO1: MLO-like protein 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g02600`	May be involved in modulation of pathogen defense and leaf cell death.	No verified direct reference in this release
`At2g44110`	May be involved in modulation of pathogen defense and leaf cell death.	No verified direct reference in this release
`At4g24250`	May be involved in modulation of pathogen defense and leaf cell death.	No verified direct reference in this release
`At2g33670`	May be involved in modulation of pathogen defense and leaf cell death.	No verified direct reference in this release
`At1g61560`	May be involved in modulation of pathogen defense and leaf cell death.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000753 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0010183 pollen tube guidance Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0072659 protein localization to plasma membrane Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0035618 root hair Cellular Component

GO:0005516 calmodulin binding Molecular Function

KEGG gene cross-reference

ath:AT1G61560

ath:AT2G33670

ath:AT2G44110

ath:AT4G02600

ath:AT4G24250

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.837

Rank 1 · LXL04_000753 · OH-1004

Cytoplasm0.123

Rank 2 · LXL04_000753 · OH-1004

Endoplasmic reticulum0.098

Rank 3 · LXL04_000753 · OH-1004

Golgi apparatus0.052

Rank 4 · LXL04_000753 · OH-1004

Lysosome / Vacuole0.045

Rank 5 · LXL04_000753 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03094.21Mlo9-471 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_000753	`PF03094.21`	Mlo	9	471	1.8e-191	637.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O49621`	Arabidopsis thaliana	MLO-like protein 1	69.835%	Swiss-Prot	strong database homology
`O80580`	Arabidopsis thaliana	MLO-like protein 15	62.579%	Swiss-Prot	strong database homology
`Q94KB2`	Arabidopsis thaliana	MLO-like protein 13	56.608%	Swiss-Prot	strong database homology
`O22815`	Arabidopsis thaliana	MLO-like protein 5	45.588%	Swiss-Prot	moderate database homology
`Q94KB7`	Arabidopsis thaliana	MLO-like protein 6	42.683%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card