LXL04_000645 | RubberDandelionOmics

Gene overview

LXL04_000645

Reference: OH-1004 Chr: Chr01 Coordinates: 11778033-11780747 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1359 bp · LXL04_000645|LXL04_000645|OH1004|cDNA

ATGTGGTTCCAGAATTTAAAGAATTTCCAGAATTTAACAGCTGAGAAGCTATCGGCAGTGAAGAAATCGAAATCGAAATCGAAGCTATCGGCAGGGACGAGTGAAGCTATCGAGATCGAAGACAGTGAAGAAATCGAAATCGAAATCGGAAGGGACGAACTGAAGACAGGCAGAGTGGCAAACAGATCGAGTGAAGACAGGCAGAGTGGCAGACAGCCTATAGTGGTAAGAAGCTACGATGGAAGTCTTGATAGATCAAG...

CDS

Download CDS FASTA

1347 bp · LXL04_000645|LXL04_000645|OH1004|CDS

ATGTGGTTCCAGAATTTAAAGAATTTCCAGAATTTAACAGCTGAGAAGCTATCGGCAGTGAAGAAATCGAAATCGAAATCGAAGCTATCGGCAGGGACGAGTGAAGCTATCGAGATCGAAGACAGTGAAGAAATCGAAATCGAAATCGGAAGGGACGAACTGAAGACAGGCAGAGTGGCAAACAGATCGAGTGAAGACAGGCAGAGTGGCAGACAGCCTATAGTGGTAAGAAGCTACGATGGAAGTCTTGATAGATCAAG...

Protein

Download Protein FASTA

448 aa · LXL04_000645|LXL04_000645|OH1004|PROTEIN

MWFQNLKNFQNLTAEKLSAVKKSKSKSKLSAGTSEAIEIEDSEEIEIEIGRDELKTGRVANRSSEDRQSGRQPIVVRSYDGSLDRSRLEVLERRCEVGPSHVFLFTDTMGDPICRIRNSPLYIMLVAEWNHELVGAIQGSIKVVRLKDLAKVGYILGLRVSPFHRRTGIGLSLVQHLEEWFIRNQVDYAYMATEKDNNASVNLFVNKLRYVRFRTPAILVHPVKSRPLKMSSKIEIFKINEENAEYLYRRFMGLTEFFPA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_000645`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_000645

Location Chr01:11778033-11780747 (-)

Description Similar to At2g23060: Probable N-acetyltransferase HLS1-like

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g23060`	Probable N-acetyltransferase HLS1-like.	No verified direct reference in this release
`At4g37580`	Ethylene-responsive N-acetyltransferase required for differential cell elongation in the hypocotyl.	Involvement of HLS1 in sugar and auxin signaling in Arabidopsis leaves.2006 · DOI: 10.1093/pcp/pcl027 Coordinated regulation of apical hook development by gibberellins and ethylene in etiolated Arabidopsis seedlings.2012 · DOI: 10.1038/cr.2012.29

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0650300`	Possesses intrinsic histone acetyltransferase activity and acts as a positive regulator of grain weight, hull size, yield, and plant biomass.	Regulation of the plastochron by three many-noded dwarf genes in barley.2021 · DOI: 10.1371/journal.pgen.1009292 The ubiquitin-interacting motif-type ubiquitin receptor HDR3 interacts with and stabilizes the histone acetyltransferase GW6a to control the grain size in rice.2021 · DOI: 10.1093/plcell/koab194

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000645 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009640 photomorphogenesis Biological Process

GO:0009723 response to ethylene Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0005634 nucleus Cellular Component

GO:0008080 N-acetyltransferase activity Molecular Function

GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups Molecular Function

KEGG gene cross-reference

ath:AT2G23060

ath:AT4G37580

osa:107275998

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.249

Rank 1 · LXL04_000645 · OH-1004

Cytoplasm0.204

Rank 2 · LXL04_000645 · OH-1004

Nucleus0.194

Rank 3 · LXL04_000645 · OH-1004

Plastid0.161

Rank 4 · LXL04_000645 · OH-1004

Endoplasmic reticulum0.101

Rank 5 · LXL04_000645 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00583.32Acetyltransf_1114-204 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_000645	`PF00583.32`	Acetyltransf_1	114	204	9e-14	52.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O64815`	Arabidopsis thaliana	Probable N-acetyltransferase HLS1-like	44.903%	Swiss-Prot	moderate database homology
`Q42381`	Arabidopsis thaliana	Probable N-acetyltransferase HLS1	45.161%	Swiss-Prot	moderate database homology
`Q67UR2`	Oryza sativa subsp. japonica	Acetyl transferase GW6a	33.095%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card