RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

LXL04_000626
Reference: OH-1004 Chr: Chr01 Coordinates: 11341250-11343521 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1329 bp · LXL04_000626|LXL04_000626|OH1004|cDNA

ATGAACAAACTGCTTCCCATGGGGTCATTGCCGACATATGACCTGGAGAATGGAGACATTATATTGAAAACTATTCCGATCCTGAAACCTCAGAAATCAACGACGTCATCCACCGATTATTCGGGGGATATTCGATTTTGGATTTTGAGAACATTTCTAGCAAATGTTCAGGGAGTTCTGTTCGGAACCAAGCTCTCTGTGCTTCTTCCGGCGATTCCGCTGGCTTTTGTCGCGCAATGTTACGATGTCGGCGGCCCATG...

CDS

Download CDS FASTA

1329 bp · LXL04_000626|LXL04_000626|OH1004|CDS

ATGAACAAACTGCTTCCCATGGGGTCATTGCCGACATATGACCTGGAGAATGGAGACATTATATTGAAAACTATTCCGATCCTGAAACCTCAGAAATCAACGACGTCATCCACCGATTATTCGGGGGATATTCGATTTTGGATTTTGAGAACATTTCTAGCAAATGTTCAGGGAGTTCTGTTCGGAACCAAGCTCTCTGTGCTTCTTCCGGCGATTCCGCTGGCTTTTGTCGCGCAATGTTACGATGTCGGCGGCCCATG...

Protein

Download Protein FASTA

442 aa · LXL04_000626|LXL04_000626|OH1004|PROTEIN

MNKLLPMGSLPTYDLENGDIILKTIPILKPQKSTTSSTDYSGDIRFWILRTFLANVQGVLFGTKLSVLLPAIPLAFVAQCYDVGGPWVFALSLIGLSPLAERVSFLTEQIACFTGPTVGGLLNATCGNATELIIALFALHQRKIDVLKFSLLGSIISNLLLVLGSSLFCGGISNLNKSQTFNRKHVDPNSSLLVLGLLCQILPLLFRYGVNEPAELASISVLNLSRASSIVLLLAYSACLFFQLKNHLTEEESNNDVREE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDLXL04_000626
Source versionOH-1004 / GCA_047496595.1_OSU_TarKok_2.0
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDLXL04_000626
LocationChr01:11341250-11343521 (-)
DescriptionSimilar to CAX4: Vacuolar cation/proton exchanger 4
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g01490 Vacuolar cation/proton exchanger (CAX).
Enhanced Cd2+ -selective root-tonoplast-transport in tobaccos expressing Arabidopsis cation exchangers.2007 · DOI: 10.1007/s00425-006-0352-7
At2g38170 Vacuolar cation/proton exchanger (CAX).
The Arabidopsis cax1 mutant exhibits impaired ion homeostasis, development, and hormonal responses and reveals interplay among vacuolar transporters.2003 · DOI: 10.1105/tpc.007385
Mutations in the Ca2+/H+ transporter CAX1 increase CBF/DREB1 expression and the cold-acclimation response in Arabidopsis.2003 · DOI: 10.1105/tpc.015248
Functional association of Arabidopsis CAX1 and CAX3 is required for normal growth and ion homeostasis.2005 · DOI: 10.1104/pp.105.061218
At3g51860 Vacuolar cation/proton exchanger (CAX).
Functional association of Arabidopsis CAX1 and CAX3 is required for normal growth and ion homeostasis.2005 · DOI: 10.1104/pp.105.061218

Rice

Reference gene IDPossible functionPapers / DOI
Os01g0557500 Vacuolar cation/proton exchanger (CAX).
Expression profile of the genes for rice cation/H+ exchanger family and functional analysis in yeast.2005 · DOI: 10.1093/pcp/pci173
Os05g0594200 Vacuolar cation/proton exchanger (CAX).
Expression profile of the genes for rice cation/H+ exchanger family and functional analysis in yeast.2005 · DOI: 10.1093/pcp/pci173
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_000626 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)
GO:0006793 phosphorus metabolic process Biological Process
GO:0006812 monoatomic cation transport Biological Process
GO:0006816 calcium ion transport Biological Process
GO:0006874 intracellular calcium ion homeostasis Biological Process
GO:0006882 intracellular zinc ion homeostasis Biological Process
GO:0009624 response to nematode Biological Process
GO:0009631 cold acclimation Biological Process
GO:0009651 response to salt stress Biological Process
GO:0009733 response to auxin Biological Process
GO:0010119 regulation of stomatal movement Biological Process
GO:0010351 lithium ion transport Biological Process
GO:0030026 intracellular manganese ion homeostasis Biological Process
KEGG gene cross-reference
ath:AT2G38170
ath:AT3G51860
ath:AT5G01490
dosa:Os01g0557500
dosa:Os05g0594200
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.430
Rank 1 · LXL04_000626 · OH-1004
Cell membrane0.307
Rank 2 · LXL04_000626 · OH-1004
Endoplasmic reticulum0.150
Rank 3 · LXL04_000626 · OH-1004
Cytoplasm0.110
Rank 4 · LXL04_000626 · OH-1004
Golgi apparatus0.091
Rank 5 · LXL04_000626 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01699.30Na_Ca_ex86-244 aa
PF01699.30Na_Ca_ex271-409 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
LXL04_000626PF01699.30Na_Ca_ex862442.3e-39135.5
LXL04_000626PF01699.30Na_Ca_ex2714092.3e-39135.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q945S5Arabidopsis thalianaVacuolar cation/proton exchanger 458.056%Swiss-Protstrong database homology
Q39253Arabidopsis thalianaVacuolar cation/proton exchanger 159.204%Swiss-Protstrong database homology
Q93Z81Arabidopsis thalianaVacuolar cation/proton exchanger 361.125%Swiss-Protstrong database homology
Q769E5Oryza sativa subsp. japonicaVacuolar cation/proton exchanger 1a60.881%Swiss-Protstrong database homology
Q5TKG3Oryza sativa subsp. japonicaVacuolar cation/proton exchanger 1b58.355%Swiss-Protstrong database homology

JBrowse

View in Genome Browser