LXL04_000616 | RubberDandelionOmics

Gene overview

LXL04_000616

Reference: OH-1004 Chr: Chr01 Coordinates: 11179607-11181124 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1176 bp · LXL04_000616|LXL04_000616|OH1004|cDNA

ATGGGTATTGCAGAAAACAATATGGATCTCTATCTCTCGCTTTTTGTTTCTTGTCTGTTGATCCTTACTCCAGGTTCTCAGGGGCATTCCAACAAACATCTGGCGCTCTTCATTTTTGGCGATTCACTTTTCGATCCTGGAAACAACAACTACATAAACACTACTCCATGGCTCCAAGCCAATTTTTGGCCGTATGGTGAATCATTCTTCAGTCCGCCAACTGGAAGATTCTCCGATGGCCGTATCATCCCTGATTTCAT...

CDS

Download CDS FASTA

1176 bp · LXL04_000616|LXL04_000616|OH1004|CDS

ATGGGTATTGCAGAAAACAATATGGATCTCTATCTCTCGCTTTTTGTTTCTTGTCTGTTGATCCTTACTCCAGGTTCTCAGGGGCATTCCAACAAACATCTGGCGCTCTTCATTTTTGGCGATTCACTTTTCGATCCTGGAAACAACAACTACATAAACACTACTCCATGGCTCCAAGCCAATTTTTGGCCGTATGGTGAATCATTCTTCAGTCCGCCAACTGGAAGATTCTCCGATGGCCGTATCATCCCTGATTTCAT...

Protein

Download Protein FASTA

391 aa · LXL04_000616|LXL04_000616|OH1004|PROTEIN

MGIAENNMDLYLSLFVSCLLILTPGSQGHSNKHLALFIFGDSLFDPGNNNYINTTPWLQANFWPYGESFFSPPTGRFSDGRIIPDFIAEFAGLPLIPAYLDPRNNDFSYGANFASAGAGVLNSSDYGRTVSLKTQLHYFVDLVKHYRKNLGDEKTEQLLSDAVYLFSCGSNDYQSLLNNNESRSRRYEQDVGMVIGSLTDLFKVIHEEGGRKIGIASLTPLGCLPPFRAQHPGNYTCDEQLNIISSLHDKALSKKLQDLA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_000616`
TK1151 ID	TkA01G599040
OH-1004 ID	LXL04_000616
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.400
Protein coverage (%)	TK1151 87.166 / OH-1004 41.432 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_000616

Location Chr01:11179607-11181124 (+)

Description Similar to GLIP: GDSL lipase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g40990`	Confers resistance to the necrotrophic fungus Alternaria brassicicola.	Secretome analysis reveals an Arabidopsis lipase involved in defense against Alternaria brassicicola.2005 · DOI: 10.1105/tpc.105.034819
`At1g53940`	Involved in the resistance to the necrotropic bacteria Erwinia carotovora, probably via negative regulation of auxin signaling.	Arabidopsis GDSL lipase 2 plays a role in pathogen defense via negative regulation of auxin signaling.2009 · DOI: 10.1016/j.bbrc.2009.01.006
`At1g53920`	GDSL esterase/lipase 5.	No verified direct reference in this release
`At3g14225`	GDSL esterase/lipase 4.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000616 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006629 lipid metabolic process Biological Process

GO:0008299 isoprenoid biosynthetic process Biological Process

GO:0009611 response to wounding Biological Process

GO:0009620 response to fungus Biological Process

GO:0009627 systemic acquired resistance Biological Process

GO:0009723 response to ethylene Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0009751 response to salicylic acid Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0009866 induced systemic resistance, ethylene mediated signaling pathway Biological Process

GO:0009871 jasmonic acid and ethylene-dependent systemic resistance, ethylene mediated signaling pathway Biological Process

GO:0010930 negative regulation of auxin mediated signaling pathway Biological Process

KEGG gene cross-reference

ath:AT1G53920

ath:AT1G53940

ath:AT3G14225

ath:AT5G40990

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.362

Rank 1 · LXL04_000616 · OH-1004

Endoplasmic reticulum0.167

Rank 2 · LXL04_000616 · OH-1004

Cell membrane0.156

Rank 3 · LXL04_000616 · OH-1004

Lysosome / Vacuole0.134

Rank 4 · LXL04_000616 · OH-1004

Cytoplasm0.118

Rank 5 · LXL04_000616 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00657.29Lipase_GDSL36-343 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_000616	`PF00657.29`	Lipase_GDSL	36	343	5.5e-29	102.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FLN0`	Arabidopsis thaliana	GDSL esterase/lipase 1	48.368%	Swiss-Prot	moderate database homology
`Q9SYF0`	Arabidopsis thaliana	GDSL esterase/lipase 2	47.181%	Swiss-Prot	moderate database homology
`Q9SSA7`	Arabidopsis thaliana	GDSL esterase/lipase 5	41.979%	Swiss-Prot	moderate database homology
`Q9LJP1`	Arabidopsis thaliana	GDSL esterase/lipase 4	44.118%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card