LXL04_000587 | RubberDandelionOmics

Gene overview

LXL04_000587

Reference: OH-1004 Chr: Chr01 Coordinates: 10593135-10594975 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

825 bp · LXL04_000587|LXL04_000587|OH1004|cDNA

ATGGCGGTCGTCTCCAGCATTGTGTTCATCATTTTCTCGGCGTTGTCGGTCGCCGAGTGCAGAATTCAGGGAAACTACGCCGGCGGTGCTTGGGAAGGAGCTCATGCTACCTTCTACGGTGGAAGCGACGCCTCCGGTACCATGGATTCTGGCAGTCGTTACGAAAATTTGGGTTTAATTTACTTCCCTTTTACAGGAGGTGCTTGTGGTTACGGCAATCTTTACAGCCAAGGATACGGAGTCAACACTGCAGCTCTTAG...

CDS

Download CDS FASTA

825 bp · LXL04_000587|LXL04_000587|OH1004|CDS

ATGGCGGTCGTCTCCAGCATTGTGTTCATCATTTTCTCGGCGTTGTCGGTCGCCGAGTGCAGAATTCAGGGAAACTACGCCGGCGGTGCTTGGGAAGGAGCTCATGCTACCTTCTACGGTGGAAGCGACGCCTCCGGTACCATGGATTCTGGCAGTCGTTACGAAAATTTGGGTTTAATTTACTTCCCTTTTACAGGAGGTGCTTGTGGTTACGGCAATCTTTACAGCCAAGGATACGGAGTCAACACTGCAGCTCTTAG...

Protein

Download Protein FASTA

274 aa · LXL04_000587|LXL04_000587|OH1004|PROTEIN

MAVVSSIVFIIFSALSVAECRIQGNYAGGAWEGAHATFYGGSDASGTMDSGSRYENLGLIYFPFTGGACGYGNLYSQGYGVNTAALSTALFNNGLSCGACFEIKCADDPRWCHPGSPSIFVTGTNFCPPNYALPNDNGGWCNPPRTHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKAGGIRFTVNGFRYFNLVLISNVAGAGDIQKVWVKGTKTNWMSMSRNWGQNWQSNAVLTGQPLSFRVTASDRRTSTSWNIAPAN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_000587`
TK1151 ID	TkA01G601890
OH-1004 ID	LXL04_000587
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	88.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_000587

Location Chr01:10593135-10594975 (-)

Description Similar to EXPA4: Expansin-A4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g39700`	Causes loosening and extension of plant cell walls by disrupting non-covalent bonding between cellulose microfibrils and matrix glucans.	No verified direct reference in this release
`At2g37640`	Causes loosening and extension of plant cell walls by disrupting non-covalent bonding between cellulose microfibrils and matrix glucans.	No verified direct reference in this release
`At3g55500`	Causes loosening and extension of plant cell walls by disrupting non-covalent bonding between cellulose microfibrils and matrix glucans.	No verified direct reference in this release
`At2g28950`	Causes loosening and extension of plant cell walls by disrupting non-covalent bonding between cellulose microfibrils and matrix glucans.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0822000`	May cause loosening and extension of plant cell walls by disrupting non-covalent bonding between cellulose microfibrils and matrix glucans.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000587 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006949 syncytium formation Biological Process

GO:0009739 response to gibberellin Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0009828 plant-type cell wall loosening Biological Process

GO:0010114 response to red light Biological Process

GO:0005576 extracellular region Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT2G28950

ath:AT2G37640

ath:AT2G39700

ath:AT3G55500

dosa:Os03g0822000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.779

Rank 1 · LXL04_000587 · OH-1004

Cytoplasm0.067

Rank 2 · LXL04_000587 · OH-1004

Lysosome / Vacuole0.055

Rank 3 · LXL04_000587 · OH-1004

Endoplasmic reticulum0.027

Rank 4 · LXL04_000587 · OH-1004

Plastid0.026

Rank 5 · LXL04_000587 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF22514.3EXPB1_D166-176 aa

PF29515.1Expansin_N66-105 aa

PF03330.25DPBB_183-170 aa

PF01357.28Expansin_C181-258 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_000587	`PF22514.3`	EXPB1_D1	66	176	4.2e-07	31.1
LXL04_000587	`PF29515.1`	Expansin_N	66	105	4.3e-07	30.8
LXL04_000587	`PF03330.25`	DPBB_1	83	170	5.3e-21	75.4
LXL04_000587	`PF01357.28`	Expansin_C	181	258	5.9e-31	107.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O48818`	Arabidopsis thaliana	Expansin-A4	74.818%	Swiss-Prot	strong database homology
`O80932`	Arabidopsis thaliana	Expansin-A3	77.692%	Swiss-Prot	strong database homology
`Q9M2S9`	Arabidopsis thaliana	Expansin-A16	73.783%	Swiss-Prot	strong database homology
`Q38865`	Arabidopsis thaliana	Expansin-A6	74.818%	Swiss-Prot	strong database homology
`Q852A1`	Oryza sativa subsp. japonica	Expansin-A7	76.718%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card