LXL04_000511 | RubberDandelionOmics

Gene overview

LXL04_000511

Reference: OH-1004 Chr: Chr01 Coordinates: 9443182-9445162 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1071 bp · LXL04_000511|LXL04_000511|OH1004|cDNA

ATGGATATCGATTTGTCGCCGAAATTGCCTAAGAAGTCATACGGAGGAGAAGGAGGATCGTACCATGCATGGTGCCCCAATGAACTCCCTATGCTCAAACAAGGCAACATCGGTGCTGGTAAACTTCTTCTAGAGAAAGACGGTCTTGCTCTCCCTCGGTTTTCCGATTCTGCTAAGGTTGCTTACGTTCTTCAAGGCAGTGGAGTCGCCGGCATAGTCCTACCGGAGAAAGAAGAGAAAGTCCTAGCAATCAAAACAGG...

CDS

Download CDS FASTA

1071 bp · LXL04_000511|LXL04_000511|OH1004|CDS

ATGGATATCGATTTGTCGCCGAAATTGCCTAAGAAGTCATACGGAGGAGAAGGAGGATCGTACCATGCATGGTGCCCCAATGAACTCCCTATGCTCAAACAAGGCAACATCGGTGCTGGTAAACTTCTTCTAGAGAAAGACGGTCTTGCTCTCCCTCGGTTTTCCGATTCTGCTAAGGTTGCTTACGTTCTTCAAGGCAGTGGAGTCGCCGGCATAGTCCTACCGGAGAAAGAAGAGAAAGTCCTAGCAATCAAAACAGG...

Protein

Download Protein FASTA

356 aa · LXL04_000511|LXL04_000511|OH1004|PROTEIN

MDIDLSPKLPKKSYGGEGGSYHAWCPNELPMLKQGNIGAGKLLLEKDGLALPRFSDSAKVAYVLQGSGVAGIVLPEKEEKVLAIKTGDSIALPFGVITWWYNKDDTELQILFLGDTKTGHKPGSFTDIFLTGSNGIFTGFSTEFVCRAWDVDESTAKSLVSSQTGTGIIKVGSGVKMPEPNKDHRSGMALNCLEAPLDVDIKGGGRVVVLNTKNLPLVGEVGFGADLVRLDGNAMCSPGFSCDSALQVTYIVRGSGRAQI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_000511`
TK1151 ID	TkA01G607180
OH-1004 ID	LXL04_000511
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_000511

Location Chr01:9443182-9445162 (-)

Description Similar to GLUD1: Glutelin type-D 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0249000`	Seed storage protein.	Characterization of a new rice glutelin gene GluD-1 expressed in the starchy endosperm.2008 · DOI: 10.1093/jxb/ern265
`Os10g0400200`	Seed storage protein.	No verified direct reference in this release
`Os01g0762500`	Seed storage protein.	No verified direct reference in this release
`Os02g0268300`	Seed storage protein.	No verified direct reference in this release
`Os02g0268100`	Seed storage protein.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000511 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0048316 seed development Biological Process

GO:0000326 protein storage vacuole Cellular Component

GO:0045735 nutrient reservoir activity Molecular Function

KEGG gene cross-reference

dosa:Os02g0249000

dosa:Os02g0268100

dosa:Os10g0400200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.411

Rank 1 · LXL04_000511 · OH-1004

Lysosome / Vacuole0.277

Rank 2 · LXL04_000511 · OH-1004

Endoplasmic reticulum0.152

Rank 3 · LXL04_000511 · OH-1004

Cytoplasm0.141

Rank 4 · LXL04_000511 · OH-1004

Cell membrane0.068

Rank 5 · LXL04_000511 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00190.29Cupin_110-156 aa

PF00190.29Cupin_1196-338 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_000511	`PF00190.29`	Cupin_1	10	156	1.3e-48	165.1
LXL04_000511	`PF00190.29`	Cupin_1	196	338	1.3e-48	165.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6K508`	Oryza sativa subsp. japonica	Glutelin type-D 1	25.065%	Swiss-Prot	weak database homology
`P07730`	Oryza sativa subsp. japonica	Glutelin type-A 2	24.561%	Swiss-Prot	weak database homology
`P07728`	Oryza sativa subsp. japonica	Glutelin type-A 1	24.812%	Swiss-Prot	weak database homology
`P14614`	Oryza sativa subsp. japonica	Glutelin type-B 4	25.193%	Swiss-Prot	weak database homology
`Q6ERU3`	Oryza sativa subsp. japonica	Glutelin type-B 5	25.193%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card