LXL04_000286 | RubberDandelionOmics

Gene overview

LXL04_000286

Reference: OH-1004 Chr: Chr01 Coordinates: 5286289-5289244 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

975 bp · LXL04_000286|LXL04_000286|OH1004|cDNA

ATGGTTGAGTACTTCGGCGagcaattatctggttttgcCTTCACCGCCAACGGGTGGGTGCAGTCTTACGGCTCCCGATGTGTCAAACCACCGATCATCTATGGCGATGTCAGTCGTCCCAAATCCATGACCGTCTTCTGGTCGTCAATGGCTCAGGAAATGACCAAACGCCCTATGAAAGGCATGCTCACGGGACCTGTCACCATCCTCAATTGGTCCTTCGTTCGGAACGATCAACCCATATACAAGACTTGCTACCA...

CDS

Download CDS FASTA

975 bp · LXL04_000286|LXL04_000286|OH1004|CDS

ATGGTTGAGTACTTCGGCGAGCAATTATCTGGTTTTGCCTTCACCGCCAACGGGTGGGTGCAGTCTTACGGCTCCCGATGTGTCAAACCACCGATCATCTATGGCGATGTCAGTCGTCCCAAATCCATGACCGTCTTCTGGTCGTCAATGGCTCAGGAAATGACCAAACGCCCTATGAAAGGCATGCTCACGGGACCTGTCACCATCCTCAATTGGTCCTTCGTTCGGAACGATCAACCCATATACAAGACTTGCTACCA...

Protein

Download Protein FASTA

324 aa · LXL04_000286|LXL04_000286|OH1004|PROTEIN

MVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKSMTVFWSSMAQEMTKRPMKGMLTGPVTILNWSFVRNDQPIYKTCYQIALAIKLKYSDQLKAMKFLDWYVKIAIVSAAVGGSMEYFIILDSITAQVLAAKRATGFNYSTIQLQLTFHLYIWQMNVEKLQKMAGAVRTGGKGSVRRKKKAVHKTTTTDDKRLQSTLKRIGVNSIPAIEEVNIFKDETVIQFLNPKVQASIAANTWVVSGSPQTKKLQDILP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_000286`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_000286

Location Chr01:5286289-5289244 (+)

Description Similar to BTF3: Basic transcription factor 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g17880`	Basic transcription factor 3.	No verified direct reference in this release
`At1g73230`	Nascent polypeptide-associated complex subunit beta.	No verified direct reference in this release
`At5g17920`	Catalyzes the transfer of a methyl group from 5-methyltetrahydrofolate to homocysteine resulting in methionine formation.	No verified direct reference in this release
`At3g03780`	Catalyzes the transfer of a methyl group from 5-methyltetrahydrofolate to homocysteine resulting in methionine formation.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os12g0624000`	Catalyzes the transfer of a methyl group from 5-methyltetrahydrofolate to homocysteine resulting in methionine formation.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000286 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006346 DNA methylation-dependent constitutive heterochromatin formation Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0009086 methionine biosynthetic process Biological Process

GO:0010043 response to zinc ion Biological Process

GO:0032259 methylation Biological Process

GO:0071266 'de novo' L-methionine biosynthetic process Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0005829 cytosol Cellular Component

KEGG gene cross-reference

ath:AT1G17880

ath:AT1G73230

ath:AT3G03780

ath:AT5G17920

dosa:Os12g0624000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.495

Rank 1 · LXL04_000286 · OH-1004

Nucleus0.418

Rank 2 · LXL04_000286 · OH-1004

Mitochondrion0.122

Rank 3 · LXL04_000286 · OH-1004

Cell membrane0.066

Rank 4 · LXL04_000286 · OH-1004

Endoplasmic reticulum0.057

Rank 5 · LXL04_000286 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01717.25Meth_synt_21-97 aa

PF01849.24NAC198-253 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_000286	`PF01717.25`	Meth_synt_2	1	97	2.5e-41	142.7
LXL04_000286	`PF01849.24`	NAC	198	253	2.9e-19	69.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SMW7`	Arabidopsis thaliana	Basic transcription factor 3	83.660%	Swiss-Prot	weak database homology
`Q9CAT7`	Arabidopsis thaliana	Nascent polypeptide-associated complex subunit beta	79.114%	Swiss-Prot	weak database homology
`O50008`	Arabidopsis thaliana	5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 1	87.755%	Swiss-Prot	weak database homology
`Q9SRV5`	Arabidopsis thaliana	5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 2	88.776%	Swiss-Prot	weak database homology
`Q2QLY4`	Oryza sativa subsp. japonica	5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 2	87.755%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card