LXL04_000173 | RubberDandelionOmics

Gene overview

LXL04_000173

Reference: OH-1004 Chr: Chr01 Coordinates: 3612408-3616147 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3186 bp · LXL04_000173|LXL04_000173|OH1004|cDNA

ATGAGTAAAATGCAGCGGAGAACGGTGACGATTAAGTGGGATAAGTTAGACGACTTCGATTTCGACGAAGACGATGAGTTCTTTGAAAGTACGAATCGTCTCTCGGCGGTGGTCCCTCTTGACATGCCAATATCTGGATTCGATCTTGATGACAACGACCAATTACAATTTGACGACGGCGTCGTTCCTTTCTCCAATAACTTTGCGGCAGTCAACTCAATCAAGAAAAATCAAAGCTTTATGGCCCCCGATTCTCAATA...

CDS

Download CDS FASTA

3186 bp · LXL04_000173|LXL04_000173|OH1004|CDS

ATGAGTAAAATGCAGCGGAGAACGGTGACGATTAAGTGGGATAAGTTAGACGACTTCGATTTCGACGAAGACGATGAGTTCTTTGAAAGTACGAATCGTCTCTCGGCGGTGGTCCCTCTTGACATGCCAATATCTGGATTCGATCTTGATGACAACGACCAATTACAATTTGACGACGGCGTCGTTCCTTTCTCCAATAACTTTGCGGCAGTCAACTCAATCAAGAAAAATCAAAGCTTTATGGCCCCCGATTCTCAATA...

Protein

Download Protein FASTA

1061 aa · LXL04_000173|LXL04_000173|OH1004|PROTEIN

MSKMQRRTVTIKWDKLDDFDFDEDDEFFESTNRLSAVVPLDMPISGFDLDDNDQLQFDDGVVPFSNNFAAVNSIKKNQSFMAPDSQYDMWMVAPGSIRDRRRRLFEDMGLNSNKDFTRLTTNKLNKAYTKRLVSIKPVVNSLDTNIADEKTNVVSAVKESPPPSKESKNVEQKQEDSRPSAENRPQPQFQSPPKLHSQQQSEPQPEPQPPPPRPAQAPVQAKAQASTLPVLLIRSRSDGDIDTNSFNAKQRKVELIGSIS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_000173`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_000173`
Location	Chr01:3612408-3616147 (+)
Description	Similar to WDR44: WD repeat-containing protein 44
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_000173` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0030334 regulation of cell migration Biological Process GO:0043001 Golgi to plasma membrane protein transport Biological Process GO:0045724 positive regulation of cilium assembly Biological Process GO:0060627 regulation of vesicle-mediated transport Biological Process GO:0061512 protein localization to cilium Biological Process GO:0061824 cytosolic ciliogenesis Biological Process GO:1902018 negative regulation of cilium assembly Biological Process GO:0005794 Golgi apparatus Cellular Component GO:0005829 cytosol Cellular Component GO:0005874 microtubule Cellular Component GO:0010008 endosome membrane Cellular Component GO:0048471 perinuclear region of cytoplasm Cellular Component
KEGG gene cross-reference	bta:286825 hsa:54521 mmu:72404 xla:734726 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.574

Rank 1 · LXL04_000173 · OH-1004

Nucleus0.281

Rank 2 · LXL04_000173 · OH-1004

Cell membrane0.157

Rank 3 · LXL04_000173 · OH-1004

Golgi apparatus0.057

Rank 4 · LXL04_000173 · OH-1004

Mitochondrion0.054

Rank 5 · LXL04_000173 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25174.2Beta-prop_THOC3595-643 aa

PF25172.2Beta-prop_WDR3_2nd595-640 aa

PF25047.1Beta-prop_TEP1_2nd595-647 aa

PF24807.2WD40_CDC20-Fz597-642 aa

PF23381.2Beta-prop_IFT122_1st598-640 aa

PF00400.39WD40601-634 aa

PF25173.2Beta-prop_WDR3_1st601-636 aa

PF25175.2Beta-prop_WDR5603-646 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_000173	`PF25174.2`	Beta-prop_THOC3	595	643	3.7e-36	125.2
LXL04_000173	`PF25172.2`	Beta-prop_WDR3_2nd	595	640	7.2e-21	75.4
LXL04_000173	`PF25047.1`	Beta-prop_TEP1_2nd	595	647	3.9e-17	63.0
LXL04_000173	`PF24807.2`	WD40_CDC20-Fz	597	642	7.8e-24	85.2
LXL04_000173	`PF23381.2`	Beta-prop_IFT122_1st	598	640	3.1e-36	125.8
LXL04_000173	`PF00400.39`	WD40	601	634	8.5e-32	108.9
LXL04_000173	`PF25173.2`	Beta-prop_WDR3_1st	601	636	1.7e-26	93.8
LXL04_000173	`PF25175.2`	Beta-prop_WDR5	603	646	3.3e-41	142.2
LXL04_000173	`PF00400.39`	WD40	701	736	8.5e-32	108.9
LXL04_000173	`PF25173.2`	Beta-prop_WDR3_1st	702	779	1.7e-26	93.8
LXL04_000173	`PF24807.2`	WD40_CDC20-Fz	702	868	7.8e-24	85.2
LXL04_000173	`PF24817.2`	WD40_WDHD1_1st	702	747	5.3e-23	82.3
LXL04_000173	`PF24805.2`	EIF3I	702	763	1.7e-16	61.0
LXL04_000173	`PF24782.3`	WD40_MABP1-WDR62_2nd	702	912	5.4e-09	36.2
LXL04_000173	`PF25175.2`	Beta-prop_WDR5	703	915	3.3e-41	142.2
LXL04_000173	`PF25168.2`	Beta-prop_WDR36-Utp21_2nd	703	762	1.9e-19	70.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card