LXL04_000037 | RubberDandelionOmics

Gene overview

LXL04_000037

Reference: OH-1004 Chr: Chr01 Coordinates: 739491-742382 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2892 bp · LXL04_000037|LXL04_000037|OH1004|cDNA

ATGGCCGAAGCTTTAGTGAGTATTGCTGCCGAGGGGATACTGAAGAAGGTGTTGTCAATCGCTGTCGGTGAACTCGCCATTACTTTGGGTTACGAAGAAAAGCTCACCACCCTTCACAACACATTAGACCTAATTCGTGCCAAGTTGAGCGATGCGGAAAGCAAAAAGGGAACACAAGCTGTAATGGTGTGGCTGAAGCAACTAAAAGATGTTGTAGGAAAAGCTGATGATGTGTTAGATGAGGTGCAGTACGAAATGTT...

CDS

Download CDS FASTA

2892 bp · LXL04_000037|LXL04_000037|OH1004|CDS

ATGGCCGAAGCTTTAGTGAGTATTGCTGCCGAGGGGATACTGAAGAAGGTGTTGTCAATCGCTGTCGGTGAACTCGCCATTACTTTGGGTTACGAAGAAAAGCTCACCACCCTTCACAACACATTAGACCTAATTCGTGCCAAGTTGAGCGATGCGGAAAGCAAAAAGGGAACACAAGCTGTAATGGTGTGGCTGAAGCAACTAAAAGATGTTGTAGGAAAAGCTGATGATGTGTTAGATGAGGTGCAGTACGAAATGTT...

Protein

Download Protein FASTA

963 aa · LXL04_000037|LXL04_000037|OH1004|PROTEIN

MAEALVSIAAEGILKKVLSIAVGELAITLGYEEKLTTLHNTLDLIRAKLSDAESKKGTQAVMVWLKQLKDVVGKADDVLDEVQYEMLRRQVEKRDQTEKIIPSLPSLKKLSFRRKMGHKIENINKMLLEINTQANGLGLHNEHPGDSTPDRLMWKETVPHLDKSTIVGRDDDKLRIIELLSQSTNKEKLTIVPVVGMGGIGKTTLAKSVYNDKIIEKRFNVKAWLCVSVKIDINTLLAKIYESFTKKKPTSDLKVNLIKS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_000037`
TK1151 ID	TkA01G640420
OH-1004 ID	LXL04_000037
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	51.300
Protein coverage (%)	TK1151 93.636 / OH-1004 27.830 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_000037

Location Chr01:739491-742382 (+)

Description Similar to RGA2: Disease resistance protein RGA2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g14470`	Potential disease resistance protein.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000037 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0051607 defense response to virus Biological Process

GO:0098542 defense response to other organism Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005524 ATP binding Molecular Function

GO:0043531 ADP binding Molecular Function

KEGG gene cross-reference

ath:AT3G14470

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.696

Rank 1 · LXL04_000037 · OH-1004

Cytoplasm0.173

Rank 2 · LXL04_000037 · OH-1004

Nucleus0.138

Rank 3 · LXL04_000037 · OH-1004

Endoplasmic reticulum0.078

Rank 4 · LXL04_000037 · OH-1004

Plastid0.030

Rank 5 · LXL04_000037 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF18052.7Rx_N13-96 aa

PF00931.29NB-ARC171-341 aa

PF23559.2WHD_DRP428-500 aa

PF23598.2LRR_14562-821 aa

PF13855.13LRR_8581-633 aa

PF12799.14LRR_4601-639 aa

PF25019.1LRR_R13L1-DRL21685-819 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_000037	`PF18052.7`	Rx_N	13	96	8.6e-15	55.3
LXL04_000037	`PF00931.29`	NB-ARC	171	341	1.8e-31	109.7
LXL04_000037	`PF23559.2`	WHD_DRP	428	500	8.7e-23	80.9
LXL04_000037	`PF23598.2`	LRR_14	562	821	5e-32	111.7
LXL04_000037	`PF13855.13`	LRR_8	581	633	1.9e-06	28.2
LXL04_000037	`PF12799.14`	LRR_4	601	639	1.8e-08	35.1
LXL04_000037	`PF25019.1`	LRR_R13L1-DRL21	685	819	2.3e-36	125.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LRR4`	Arabidopsis thaliana	Putative disease resistance RPP13-like protein 1	31.230%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card