LXL04_000028 | RubberDandelionOmics

Gene overview

LXL04_000028

Reference: OH-1004 Chr: Chr01 Coordinates: 568382-573309 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1467 bp · LXL04_000028|LXL04_000028|OH1004|cDNA

ATGGCGACACCGGGGGCATACGACCAACACCTGCCGGCAGTTCCCGATTGGCTTAACAAAGGCGACAACGCATGGCAAATGACAGCATCTGCCCTCGTCGGCCTCCAGAGCATGCCGGGACTCGTCATCCTCTACGCTTCAATCGTCAAAAAGAAATGGGCGGTCAACTCCGCCTTCATGGTCCTCTACGCCTTCGCCGCCGTTCTCATATGCTGGGTACTAGTTTGCTACCGTATGGCTTTCGGCGACCAACTCTTGCC...

CDS

Download CDS FASTA

1467 bp · LXL04_000028|LXL04_000028|OH1004|CDS

ATGGCGACACCGGGGGCATACGACCAACACCTGCCGGCAGTTCCCGATTGGCTTAACAAAGGCGACAACGCATGGCAAATGACAGCATCTGCCCTCGTCGGCCTCCAGAGCATGCCGGGACTCGTCATCCTCTACGCTTCAATCGTCAAAAAGAAATGGGCGGTCAACTCCGCCTTCATGGTCCTCTACGCCTTCGCCGCCGTTCTCATATGCTGGGTACTAGTTTGCTACCGTATGGCTTTCGGCGACCAACTCTTGCC...

Protein

Download Protein FASTA

488 aa · LXL04_000028|LXL04_000028|OH1004|PROTEIN

MATPGAYDQHLPAVPDWLNKGDNAWQMTASALVGLQSMPGLVILYASIVKKKWAVNSAFMVLYAFAAVLICWVLVCYRMAFGDQLLPFWGKGAPALGQKYLARQALIPETIHHYSNGTIENPATQPFYPMATLVYFQFTFAAITMILLAGSVLGRMNIRAWMAFVPLWLVFSYTVGAFSLWGGGFLYQWGVIDYSGGYVIHLSSGIAGFTAAYWVGPRLRSDRERFPPNNVLLMLAGAGLLWMGWSGFNGGAPYAATITA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_000028`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_000028

Location Chr01:568382-573309 (-)

Description Similar to AMT2: Ammonium transporter 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g38290`	High affinity ammonium transporter that may play an important role in moving ammonium between the apoplast and symplast of cells throughout the plant.	Characterization of Arabidopsis AtAMT2, a high-affinity ammonium transporter of the plasma membrane.2002 · DOI: 10.1104/pp.008599

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0870300`	Involved in ammonium transport.	No verified direct reference in this release
`Os01g0831900`	Involved in ammonium transport.	No verified direct reference in this release
`Os05g0468700`	Involved in ammonium transport.	No verified direct reference in this release
`Os02g0550800`	Involved in ammonium transport.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000028 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009624 response to nematode Biological Process

GO:0072488 ammonium transmembrane transport Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0008519 ammonium channel activity Molecular Function

KEGG gene cross-reference

ath:AT2G38290

dosa:Os01g0831900

dosa:Os01g0870300

dosa:Os02g0550800

dosa:Os05g0468700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.823

Rank 1 · LXL04_000028 · OH-1004

Cytoplasm0.134

Rank 2 · LXL04_000028 · OH-1004

Lysosome / Vacuole0.053

Rank 3 · LXL04_000028 · OH-1004

Endoplasmic reticulum0.052

Rank 4 · LXL04_000028 · OH-1004

Golgi apparatus0.036

Rank 5 · LXL04_000028 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00909.27Ammonium_transp24-448 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_000028	`PF00909.27`	Ammonium_transp	24	448	1.1e-79	268.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M6N7`	Arabidopsis thaliana	Ammonium transporter 2	74.793%	Swiss-Prot	strong database homology
`Q84KJ6`	Oryza sativa subsp. japonica	Ammonium transporter 3 member 1	73.060%	Swiss-Prot	strong database homology
`Q8S230`	Oryza sativa subsp. japonica	Ammonium transporter 2 member 2	69.309%	Swiss-Prot	strong database homology
`Q84KJ7`	Oryza sativa subsp. japonica	Ammonium transporter 2 member 1	77.056%	Swiss-Prot	strong database homology
`Q69T29`	Oryza sativa subsp. japonica	Ammonium transporter 3 member 3	69.877%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card