LXL04_000007 | RubberDandelionOmics

Gene overview

LXL04_000007

Reference: OH-1004 Chr: Chr01 Coordinates: 135159-135818 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

660 bp · LXL04_000007|LXL04_000007|OH1004|cDNA

ATGGCTTCATCACCGGCGATCCTTCCCATCTCAAACCAACATACCATTTCCAGCGGTGAAGCCCTCGCGCCCGTTTCCACCCCTGCCTTCCGTTCTTTCATCAACAACATCACCGAAACCGTCCGATCTGGACTCTCCAGTCGCCGTCCATGGTCTGAACTCGTCGACCGCTCTGCGTTCTCAAAACCAGACTCCATAACCGACGCCGCAGGCCGGATCCGAAAGAACTACTCCTACTTCCGTGTCAACTATATCACTGT...

CDS

Download CDS FASTA

660 bp · LXL04_000007|LXL04_000007|OH1004|CDS

ATGGCTTCATCACCGGCGATCCTTCCCATCTCAAACCAACATACCATTTCCAGCGGTGAAGCCCTCGCGCCCGTTTCCACCCCTGCCTTCCGTTCTTTCATCAACAACATCACCGAAACCGTCCGATCTGGACTCTCCAGTCGCCGTCCATGGTCTGAACTCGTCGACCGCTCTGCGTTCTCAAAACCAGACTCCATAACCGACGCCGCAGGCCGGATCCGAAAGAACTACTCCTACTTCCGTGTCAACTATATCACTGT...

Protein

Download Protein FASTA

219 aa · LXL04_000007|LXL04_000007|OH1004|PROTEIN

MASSPAILPISNQHTISSGEALAPVSTPAFRSFINNITETVRSGLSSRRPWSELVDRSAFSKPDSITDAAGRIRKNYSYFRVNYITVIAAVLGFSLLTNPFSLIILVGLLAAWLFLYLFRPSDPPLVIFGRTFSERETLGLLIVSSIVVIFLTSVGSVLISALLLGTAVVSAHGAFRTPEDLFLDEQEPGASTGFLSFLSGAATSAAASAAPVVAAARV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_000007`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_000007

Location Chr01:135159-135818 (+)

Description Similar to PRA1B4: PRA1 family protein B4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g38360`	May be involved in both secretory and endocytic intracellular trafficking in the endosomal/prevacuolar compartments.	No verified direct reference in this release
`At5g01640`	May be involved in both secretory and endocytic intracellular trafficking in the endosomal/prevacuolar compartments.	No verified direct reference in this release
`At3g56110`	May be involved in both secretory and endocytic intracellular trafficking in the endosomal/prevacuolar compartments.	No verified direct reference in this release
`At5g05380`	May be involved in both secretory and endocytic intracellular trafficking in the endosomal/prevacuolar compartments.	No verified direct reference in this release
`At2g40380`	May be involved in both secretory and endocytic intracellular trafficking in the endosomal/prevacuolar compartments.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000007 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0016192 vesicle-mediated transport Biological Process

GO:0000138 Golgi trans cisterna Cellular Component

GO:0005768 endosome Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005802 trans-Golgi network Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0010008 endosome membrane Cellular Component

KEGG gene cross-reference

ath:AT2G38360

ath:AT2G40380

ath:AT3G56110

ath:AT5G01640

ath:AT5G05380

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.404

Rank 1 · LXL04_000007 · OH-1004

Endoplasmic reticulum0.265

Rank 2 · LXL04_000007 · OH-1004

Cytoplasm0.228

Rank 3 · LXL04_000007 · OH-1004

Lysosome / Vacuole0.141

Rank 4 · LXL04_000007 · OH-1004

Cell membrane0.117

Rank 5 · LXL04_000007 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03208.25PRA144-187 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_000007	`PF03208.25`	PRA1	44	187	8.3e-50	168.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O80915`	Arabidopsis thaliana	PRA1 family protein B4	69.565%	Swiss-Prot	strong database homology
`Q9M012`	Arabidopsis thaliana	PRA1 family protein B5	60.294%	Swiss-Prot	strong database homology
`Q9LYN0`	Arabidopsis thaliana	PRA1 family protein B1	57.868%	Swiss-Prot	strong database homology
`Q9FLB6`	Arabidopsis thaliana	PRA1 family protein B3	60.302%	Swiss-Prot	strong database homology
`Q9SIY7`	Arabidopsis thaliana	PRA1 family protein B2	57.789%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card