TkAUNG098360 | RubberDandelionOmics

Gene overview

TkAUNG098360

Reference: TK1151 Chr: ChrUn Coordinates: 27787270-27789727 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1942 bp · TkAUNG098360|TK1151|cDNA

AGAACCCTAATCCCACGAGTAAAGACGCCAAAGTTTACAACAAAAGTGCGAATTTTCAACGAAGAATTATGGGGCAGGAATAATCAAAATCTCAACTTTCACCCCCACCTTCTCTACGATTCATCCCAAAACATCAAATCTCGAATTCCCTTCTATCCCTTTCATGGTTTTGCCTCACAAACAAACAAATCATCAGTATCAGTACTAATCTTCCACCCTCATCCTCCATTAATGCATCAACGAACCTTCGACCTCACTCG...

CDS

Download CDS FASTA

1674 bp · TkAUNG098360|TK1151|CDS

AGAACCCTAATCCCACGAGTAAAGACGCCAAAGTTTACAACAAAAGTGCGAATTTTCAACGAAGAATTATGGGGCAGGAATAATCAAAATCTCAACTTTCACCCCCACCTTCTCTACGATTCATCCCAAAACATCAAATCTCGAATTCCCTTCTATCCCTTTCATGGTTTTGCCTCACAAACAAACAAATCATCAGTATCAGTACTAATCTTCCACCCTCATCCTCCATTAATGCATCAACGAACCTTCGACCTCACTCG...

Protein

Download Protein FASTA

557 aa · TkAUNG098360|TK1151|PROTEIN

RTLIPRVKTPKFTTKVRIFNEELWGRNNQNLNFHPHLLYDSSQNIKSRIPFYPFHGFASQTNKSSVSVLIFHPHPPLMHQRTFDLTRHSSIPHYGVPHSYPSLPQNPRIRISNFKTNCCYTRHKHFVRTNNGPVNCISYGIDVAVSKHRRLPSVNFSGEKEFDVATLGNLCVDVVLNVPNLPPSSFDERKNYMEQLAKSPPDKKHWEAGGNCNMAIAAARLGLRCIVIGHVGDEIYGNFLLDVLQDEGINLIEMKEQDDT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG098360`
TK1151 ID	TkAUNG098360
OH-1004 ID	LXL04_036907
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	99.800
Protein coverage (%)	TK1151 86.176 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG098360

Location ChrUn:27787270-27789727 (-)

Description Similar to iolC: 5-dehydro-2-deoxygluconokinase (Bacillus thuringiensis subsp. konkukian (strain 97-27)

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g66430`	May play an important role in maintaining the flux of carbon towards starch formation.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036907 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0019310 inositol catabolic process Biological Process

GO:0005524 ATP binding Molecular Function

GO:0047590 5-dehydro-2-deoxygluconokinase activity Molecular Function

KEGG gene cross-reference

bah:BAMEG_2090

bai:BAA_2568

ban:BA_2512

banh:HYU01_12470

bar:GBAA_2512

bat:BAS2333

bcz:BCE33L2252

btk:BT9727_2296

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.959

Rank 1 · TkAUNG098360 · TK1151

Mitochondrion0.060

Rank 2 · TkAUNG098360 · TK1151

Cytoplasm0.042

Rank 3 · TkAUNG098360 · TK1151

Nucleus0.029

Rank 4 · TkAUNG098360 · TK1151

Peroxisome0.023

Rank 5 · TkAUNG098360 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23660NOMO_8th10-54 aa

PF00294PfkB165-483 aa

PF06465DUF1087190-207 aa

PF08543Phos_pyr_kin363-471 aa

PF06465DUF1087495-521 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG098360	`PF23660`	NOMO_8th	10	54	0.28	12.0
TkAUNG098360	`PF00294`	PfkB	165	483	1.6e-34	120.4
TkAUNG098360	`PF06465`	DUF1087	190	207	0.31	11.9
TkAUNG098360	`PF08543`	Phos_pyr_kin	363	471	0.0031	17.7
TkAUNG098360	`PF06465`	DUF1087	495	521	0.31	11.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C524`	Arabidopsis thaliana	sp\|Q9C524\|SCRK6_ARATH Probable fructokinase-6, chloroplastic	25.400%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card