TkAUNG098160 | RubberDandelionOmics

Gene overview

TkAUNG098160

Reference: TK1151 Chr: ChrUn Coordinates: 27730114-27731301 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

375 bp · TkAUNG098160|TK1151|cDNA

ATGAAGGATTCAAAAGACTATTATGGCCTTGCTCCTGGAAAGACCGTTCGTCCTACTCAGGGGGTTCTTCACTGGGTGGCAGAGCCTTCTCCTGGAGTTGACCTGTTAAAAGTGGAAGTCAGACTTTTTGACAAACTCTTTCATTCTGAGGAGCTTTTGGACAAACTTGTTATATTTAAAATCAATGACAATGAAGGGACAAATATGGGATTTGATGGGCCACACTATGAGAAAAGCAACCAAGTTTTGTTGGATGATAT...

CDS

Download CDS FASTA

375 bp · TkAUNG098160|TK1151|CDS

ATGAAGGATTCAAAAGACTATTATGGCCTTGCTCCTGGAAAGACCGTTCGTCCTACTCAGGGGGTTCTTCACTGGGTGGCAGAGCCTTCTCCTGGAGTTGACCTGTTAAAAGTGGAAGTCAGACTTTTTGACAAACTCTTTCATTCTGAGGAGCTTTTGGACAAACTTGTTATATTTAAAATCAATGACAATGAAGGGACAAATATGGGATTTGATGGGCCACACTATGAGAAAAGCAACCAAGTTTTGTTGGATGATAT...

Protein

Download Protein FASTA

124 aa · TkAUNG098160|TK1151|PROTEIN

MKDSKDYYGLAPGKTVRPTQGVLHWVAEPSPGVDLLKVEVRLFDKLFHSEELLDKLVIFKINDNEGTNMGFDGPHYEKSNQVLLDDMIRGDLALTGSIRGVELRIFPSNQLPEISHLQSGFQDQ

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG098160`
TK1151 ID	TkAUNG098160
OH-1004 ID	LXL04_035451
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	87.800
Protein coverage (%)	TK1151 33.065 / OH-1004 4.039 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG098160

Location ChrUn:27730114-27731301 (+)

Description Similar to BAZ2B: Bromodomain adjacent to zinc finger domain protein 2B

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g25350`	Glutamine--tRNA ligase, cytoplasmic.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035451 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0034244 negative regulation of transcription elongation by RNA polymerase II Biological Process

GO:0045814 negative regulation of gene expression, epigenetic Biological Process

GO:2000028 regulation of photoperiodism, flowering Biological Process

GO:0000785 chromatin Cellular Component

GO:0005634 nucleus Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0008270 zinc ion binding Molecular Function

GO:0042393 histone binding Molecular Function

GO:0061628 histone H3K27me3 reader activity Molecular Function

GO:0140566 histone reader activity Molecular Function

KEGG gene cross-reference

ath:AT1G43770

ath:AT5G16680

ath:AT5G61100

gga:395400

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.465

Rank 1 · TkAUNG098160 · TK1151

Nucleus0.271

Rank 2 · TkAUNG098160 · TK1151

Extracellular0.171

Rank 3 · TkAUNG098160 · TK1151

Mitochondrion0.105

Rank 4 · TkAUNG098160 · TK1151

Peroxisome0.066

Rank 5 · TkAUNG098160 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF20974tRNA-synt_1c_C222-65 aa

PF01704UDPGP46-74 aa

PF23121SPOC_AIPP275-116 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG098160	`PF20974`	tRNA-synt_1c_C2	22	65	0.0033	18.9
TkAUNG098160	`PF01704`	UDPGP	46	74	0.0087	15.5
TkAUNG098160	`PF23121`	SPOC_AIPP2	75	116	4.5e-08	34.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8W4F3`	Arabidopsis thaliana	sp\|Q8W4F3\|SYQ_ARATH Glutamine--tRNA ligase, cytoplasmic	45.200%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card