RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkAUNG096520
Reference: TK1151 Chr: ChrUn Coordinates: 27287171-27291098 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2405 bp · TkAUNG096520|TK1151|cDNA

ATGGAGGGGTTCATGAATTCTGTAAATTCTCATATGTGTATTGATCTTGCAAATGTCAATCTTATAAATTTGGTCCTAATTTGTTGAAATTAGTAGAAACATTAGGTTTCTGTGAGCGTTAGGGTTTTAAGAAATCGTGGGAAAGAGAATGGGATTGGAGAGTCTGCTTATTCTAACAGTAGATCCACCAATAAAACGGCGAGCAGGGCTACGGAGAAAACAGGCTGGGAGAGGCTCTTACAGGGGGAGCTAGTCGCTAG...

CDS

Download CDS FASTA

1581 bp · TkAUNG096520|TK1151|CDS

ATGGGGGTTAGTGCATTACACCAAGCACTCAAGAATCTCTGTCTTAACACCGACTGGAATTATGCCGTCTTTTGGAAACTCAATCCAGGAGCTCGAATGATGTTGACTTGCGAAGATGCTTATTATGACAAAAATGATCCTTCAGGGGGCATAAAACGGTTCGATAAAATGATGGGAAATTTGCCTGAACAAGATCTTCTTGACCTAGCAGTGGCAAATATGTCTTTTCACAGATATGCTCTCGGGGAAGGAGTTGTTGG...

Protein

Download Protein FASTA

526 aa · TkAUNG096520|TK1151|PROTEIN

MGVSALHQALKNLCLNTDWNYAVFWKLNPGARMMLTCEDAYYDKNDPSGGIKRFDKMMGNLPEQDLLDLAVANMSFHRYALGEGVVGRVALADKHLWICGDQLVNDPRLSFEDYDGWRTQFAAGIRTILVVGVIPHGVIQLGSLKNIPEDLKTVNDIRETFLELQTSLTGYIPTITNSYTDTITSINFGIDNRNPESQTPIPSNFQIETNTMENTSFNFPAGCELYEALGPAFYAQNESYNGQTVNEMPGMNNSGLLTPN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkAUNG096520
TK1151 IDTkAUNG096520
OH-1004 IDLXL04_000956
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)98.700
Protein coverage (%)TK1151 98.669 / OH-1004 88.416
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkAUNG096520
LocationChrUn:27287171-27291098 (+)
DescriptionSimilar to EMB1444: Transcription factor EMB1444
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g06150 Transcription factor that may regulate root development. No verified direct reference in this release
At2g31280 Transcription factor that may regulate root development. No verified direct reference in this release
At2g27230 Transcription activator that regulates root development; promotes the production of stele cells in roots. No verified direct reference in this release
At1g64625 Transcription factor that may regulate root development. No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
Os11g0446000 Involved in the repression of jasmonate (JA)-induced genes.
RICE SALT SENSITIVE3 forms a ternary complex with JAZ and class-C bHLH factors and regulates jasmonate-induced gene expression and root cell elongation.2013 · DOI: 10.1105/tpc.113.112052
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_000956 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006351 DNA-templated transcription Biological Process
GO:0006355 regulation of DNA-templated transcription Biological Process
GO:0007140 male meiotic nuclear division Biological Process
GO:0010089 xylem development Biological Process
GO:0048316 seed development Biological Process
GO:0048364 root development Biological Process
GO:0051321 meiotic cell cycle Biological Process
GO:0071365 cellular response to auxin stimulus Biological Process
GO:0090058 metaxylem development Biological Process
GO:0005634 nucleus Cellular Component
GO:0003677 DNA binding Molecular Function
GO:0003700 DNA-binding transcription factor activity Molecular Function
KEGG gene cross-reference
ath:AT1G06150
ath:AT1G64625
ath:AT2G31280
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.902
Rank 1 · TkAUNG096520 · TK1151
Cytoplasm0.155
Rank 2 · TkAUNG096520 · TK1151
Cell membrane0.048
Rank 3 · TkAUNG096520 · TK1151
Endoplasmic reticulum0.030
Rank 4 · TkAUNG096520 · TK1151
Plastid0.018
Rank 5 · TkAUNG096520 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14215bHLH-MYC_N6-161 aa
PF06529Vert_IL3-reg_TF261-330 aa
PF22299BRISC_FAM175B_helical263-282 aa
PF23176bHLH_LHW351-412 aa
PF00010HLH358-395 aa
PF22754bHLH-TF_ACT-like_plant444-483 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkAUNG096520PF14215bHLH-MYC_N61611.5e-31110.8
TkAUNG096520PF06529Vert_IL3-reg_TF2613300.2311.3
TkAUNG096520PF22299BRISC_FAM175B_helical2632820.1612.4
TkAUNG096520PF23176bHLH_LHW3514121.4e-37128.2
TkAUNG096520PF00010HLH3583950.0116.4
TkAUNG096520PF22754bHLH-TF_ACT-like_plant4444830.03315.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
P0C7P8Arabidopsis thalianasp|P0C7P8|LHWL1_ARATH Transcription factor EMB144446.400%Swiss-ProtMedium
Q58G01Arabidopsis thalianasp|Q58G01|LHWL3_ARATH Transcription factor bHLH15546.600%Swiss-ProtMedium
Q9XIN0Arabidopsis thalianasp|Q9XIN0|LHW_ARATH Transcription factor LHW32.000%Swiss-ProtMedium
Q7XJU0Arabidopsis thalianasp|Q7XJU0|LHWL2_ARATH Transcription factor bHLH15731.600%Swiss-ProtMedium
K4PW38Oryza sativa subsp. japonicasp|K4PW38|RSS3_ORYSJ Protein RICE SALT SENSITIVE 335.100%Swiss-ProtLow

JBrowse

View in Genome Browser