TkAUNG096090 | RubberDandelionOmics

Gene overview

TkAUNG096090

Reference: TK1151 Chr: ChrUn Coordinates: 27175466-27177255 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1585 bp · TkAUNG096090|TK1151|cDNA

AACTCTCTGGTGAAATTCCGGCAAGTTTGTCTTCACCAAGGCTAAGCCTTATTGATTTGTCTAACAATATGCTGAGTGGGCGGGTGCCGGAATCTTTATTGGCGGTAGAGTATGGTGGTAGCTTCGCCGGAAATCCAGGGTTATGTGGCGACGGTAGCAGAGGTCTCAGGCAATGTTCGCTGGTTTCTCGTAGGTCCGGCGGGTTGGGAGTTGCGAAGTATTGCATCATCGGCGGTGTGCTAGTTTTAGTGTTGTCGTTA...

CDS

Download CDS FASTA

687 bp · TkAUNG096090|TK1151|CDS

ATGAGTGAGGACTCAAATCTACTTGTTTATGAGTACATGACTAGAGGTAGCTTATGGGATCGGCTACATACGGATCAGAAGATTGATATGGATTGGAAGGTTCGCTATGAAATTGCAGTGGGGGCCGCAAGGGGATTGGAGTACCTACATCACGGGTGTGATATACCTGTGATACATCGGGATGTGAAGTCGAGCAATATTTTGTTGGATGAGGACATGAAGCCGAAAATAGCTGATTTTGGACTTGCGAAGATCGTGCA...

Protein

Download Protein FASTA

228 aa · TkAUNG096090|TK1151|PROTEIN

MSEDSNLLVYEYMTRGSLWDRLHTDQKIDMDWKVRYEIAVGAARGLEYLHHGCDIPVIHRDVKSSNILLDEDMKPKIADFGLAKIVQINNVMDSTHVIAGTYGYIAPEYGYTLNVNEKSDIYSFGVVLMELITGKKPVQPEFGENKDIVRWVQDKLRGNENPIALVDPTIPDDFKGHAVNAFTIAMHCTMRIPTLRPSMRMVVQMLEKIKPYSHIDIAIENDINVVKN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG096090`
TK1151 ID	TkAUNG096090
OH-1004 ID	LXL04_017256
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	75.300
Protein coverage (%)	TK1151 96.053 / OH-1004 22.393 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG096090

Location ChrUn:27175466-27177255 (+)

Description Similar to RLK7: Receptor-like protein kinase 7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g09970`	Plays a role in pattern-triggered immunity (PTI) signaling induced by pathogen-associated molecular patterns (PAMPs).	RLK7, a leucine-rich repeat receptor-like kinase, is required for proper germination speed and tolerance to oxidative stress in Arabidopsis thaliana.2010 · DOI: 10.1007/s00425-010-1260-4 The secreted peptide PIP1 amplifies immunity through receptor-like kinase 7.2014 · DOI: 10.1371/journal.ppat.1004331
`At3g19700`	Modulates the seed size by negatively regulating the cellularization of syncytial endosperm.	MINISEED3 (MINI3), a WRKY family gene, and HAIKU2 (IKU2), a leucine-rich repeat (LRR) KINASE gene, are regulators of seed size in Arabidopsis.2005 · DOI: 10.1073/pnas.0508418102
`At5g49660`	Receptor kinase involved in the perception of C-terminally encoded plant signaling peptide (CEP) and subsequent regulation of root and shoot development.	XYLEM INTERMIXED WITH PHLOEM1, a leucine-rich repeat receptor-like kinase required for stem growth and vascular development in Arabidopsis thaliana.2012 · DOI: 10.1007/s00425-011-1489-6 CEP5 and XIP1/CEPR1 regulate lateral root initiation in Arabidopsis.2016 · DOI: 10.1093/jxb/erw231
`At1g08590`	Involved in the regulation of procambium maintenance and polarity during vascular-tissue development.	No verified direct reference in this release
`At4g28650`	Involved in the regulation of procambium maintenance and polarity during vascular-tissue development.	A receptor heteromer mediates the male perception of female attractants in plants.2016 · DOI: 10.1038/nature16975

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017256 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0009845 seed germination Biological Process

GO:0009960 endosperm development Biological Process

GO:0010051 xylem and phloem pattern formation Biological Process

GO:0010311 lateral root formation Biological Process

GO:0010555 response to mannitol Biological Process

GO:0031540 regulation of anthocyanin biosynthetic process Biological Process

GO:0045087 innate immune response Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0048437 floral organ development Biological Process

KEGG gene cross-reference

ath:AT1G09970

ath:AT1G28440

ath:AT1G72180

ath:AT3G19700

ath:AT5G49660

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.509

Rank 1 · TkAUNG096090 · TK1151

Cytoplasm0.426

Rank 2 · TkAUNG096090 · TK1151

Nucleus0.205

Rank 3 · TkAUNG096090 · TK1151

Golgi apparatus0.049

Rank 4 · TkAUNG096090 · TK1151

Endoplasmic reticulum0.045

Rank 5 · TkAUNG096090 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase3-203 aa

PF07714PK_Tyr_Ser-Thr3-161 aa

PF12260PIP49_C7-81 aa

PF03109ABC147-90 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG096090	`PF00069`	Pkinase	3	203	1e-31	111.0
TkAUNG096090	`PF07714`	PK_Tyr_Ser-Thr	3	161	3.5e-30	105.9
TkAUNG096090	`PF12260`	PIP49_C	7	81	0.076	13.3
TkAUNG096090	`PF03109`	ABC1	47	90	0.095	12.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4I2N7`	Arabidopsis thaliana	sp\|F4I2N7\|RLK7_ARATH Receptor-like protein kinase 7	60.100%	Swiss-Prot	High
`Q9LJM4`	Arabidopsis thaliana	sp\|Q9LJM4\|IKU2_ARATH Receptor-like protein kinase HAIKU2	59.300%	Swiss-Prot	High
`Q9FGL5`	Arabidopsis thaliana	sp\|Q9FGL5\|CEPR1_ARATH Receptor protein-tyrosine kinase CEPR1	51.900%	Swiss-Prot	High
`Q9FRS6`	Arabidopsis thaliana	sp\|Q9FRS6\|PXL1_ARATH Leucine-rich repeat receptor-like protein kinase PXL1	45.900%	Swiss-Prot	Medium
`Q9M0G7`	Arabidopsis thaliana	sp\|Q9M0G7\|MIK1_ARATH MDIS1-interacting receptor like kinase 1	47.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card