TkAUNG095710 | RubberDandelionOmics

Gene overview

TkAUNG095710

Reference: TK1151 Chr: ChrUn Coordinates: 27051022-27052544 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1121 bp · TkAUNG095710|TK1151|cDNA

CATGATATGATTACAACCCCTTTGTTTCTTTCTTTCTTGATTTGTCTATATAATTGACACTCTCCATCAACCATGTTTTGACCCATCCATGGGACTTAGCAGCATGAAGGTGCATCAGTTTGCACGTGGTGGTGGGTTCTGGCGGGACGATGAATCCTCATCCTCTGGCCTCACCCTCGGTCTCTGCAAACGCTTGCATCCTCTCACACCTAACATGACATGTAGTGATAGTACGGACACTAGTTTCACCATGAACAATA...

CDS

Download CDS FASTA

363 bp · TkAUNG095710|TK1151|CDS

ATGTTATATAGAGGGGGAATGCGGACTCCAAACGCACAACAAATCGAACAAATTACCTCACAACTATGCAAGTACGGCAAGATAGAAGGCAAGAATGTGTTTTATTGGTTCCAGAATCACAAAGCACGAGAGAGGCAGAAGCAGAAGCGTAACAACCTCGGTCTAAATCATTCTTTGAGATCATCCCCAGCCTCCACCATGATCAACTCCATGTCATTAAACCCTAGAGGAGAAGTAGTGGAGAGTCCATACAAGAAGTG...

Protein

Download Protein FASTA

120 aa · TkAUNG095710|TK1151|PROTEIN

MLYRGGMRTPNAQQIEQITSQLCKYGKIEGKNVFYWFQNHKARERQKQKRNNLGLNHSLRSSPASTMINSMSLNPRGEVVESPYKKCRSWSFEYCLEKEEEDNKTLELFPLHPEGRSRSS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG095710`
TK1151 ID	TkAUNG095710
OH-1004 ID	LXL04_008110
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 49.180 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG095710

Location ChrUn:27051022-27052544 (-)

Description Similar to WOX4: WUSCHEL-related homeobox 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g46480`	Promotes differentiation and/or maintenance of the vascular procambium, the initial cells of the developing vasculature.	WOX4 promotes procambial development.2010 · DOI: 10.1104/pp.109.149641 TDIF peptide signaling regulates vascular stem cell proliferation via the WOX4 homeobox gene in Arabidopsis.2010 · DOI: 10.1105/tpc.110.076083 WOX4 imparts auxin responsiveness to cambium cells in Arabidopsis.2011 · DOI: 10.1105/tpc.111.087874

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: Q25AM2`	Transcription factor which may be involved in developmental processes.	No verified direct reference in this release
`Os04g0649400`	Transcription factor which may be involved in developmental processes.	No verified direct reference in this release
`UniProt: A2XZR3`	Transcription factor which may be involved in developmental processes.	No verified direct reference in this release
`Os05g0118700`	Transcription factor which may be involved in developmental processes.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008110 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0007165 signal transduction Biological Process

GO:0009888 tissue development Biological Process

GO:0010067 procambium histogenesis Biological Process

GO:0010087 phloem or xylem histogenesis Biological Process

GO:0051301 cell division Biological Process

GO:0099402 plant organ development Biological Process

GO:0005634 nucleus Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

KEGG gene cross-reference

ath:AT1G46480

dosa:Os04g0649400

osa:107275686

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.979

Rank 1 · TkAUNG095710 · TK1151

Cytoplasm0.086

Rank 2 · TkAUNG095710 · TK1151

Cell membrane0.019

Rank 3 · TkAUNG095710 · TK1151

Endoplasmic reticulum0.010

Rank 4 · TkAUNG095710 · TK1151

Plastid0.008

Rank 5 · TkAUNG095710 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00046Homeodomain7-46 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG095710	`PF00046`	Homeodomain	7	46	3.5e-09	37.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6X7J9`	Arabidopsis thaliana	sp\|Q6X7J9\|WOX4_ARATH WUSCHEL-related homeobox 4	57.000%	Swiss-Prot	High
`Q25AM2`	Oryza sativa subsp. indica	sp\|Q25AM2\|WOX4_ORYSI WUSCHEL-related homeobox 4	47.100%	Swiss-Prot	Medium
`Q7XTV3`	Oryza sativa subsp. japonica	sp\|Q7XTV3\|WOX4_ORYSJ WUSCHEL-related homeobox 4	47.100%	Swiss-Prot	Medium
`A2XZR3`	Oryza sativa subsp. indica	sp\|A2XZR3\|WOX2_ORYSI Putative WUSCHEL-related homeobox 2	75.500%	Swiss-Prot	Low
`Q5W7C3`	Oryza sativa subsp. japonica	sp\|Q5W7C3\|WOX2_ORYSJ Putative WUSCHEL-related homeobox 2	75.500%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card