TkAUNG094630 | RubberDandelionOmics

Gene overview

TkAUNG094630

Reference: TK1151 Chr: ChrUn Coordinates: 26756420-26761409 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1673 bp · TkAUNG094630|TK1151|cDNA

AAAAAGAAAAAGAAAATGTATTTTATTTCCGGTTAGAGCGGGGAATGAAATCGTCCATTTCGAAGAAACTCACAACCAAAAATGGAAGTTGGAGAATACAGAATAGTCGACGGACTCCAGAGGCCCAAATTCATTAGTTCGCCGGAGGTCGGAAAAGGAATTCCGGTACGGAAATTGGACGAGATCCAAACGCAGCAATGTTTCTGACGGCCAAGATCAAATCCGTCGATTTTTTCAGGAAAATCCCAAGAGATTTGACA...

CDS

Download CDS FASTA

1299 bp · TkAUNG094630|TK1151|CDS

ATGTTTCTGACGGCCAAGATCAAATCCGTCGATTTTTTCAGGAAAATCCCAAGAGATTTGACAGAGGCATCACTTTCAGGTGCTGGATTATCCATTATGGCAGCTTTCTCTATGATGTTTTTGTTTGGAATGGAGCTACAGAATTATTTGACTATGAGTACTACGACTTCTGTGATCGTGGACCAAAGTTCTGACTCAGAAATCTTACTCATTGGTTTCAATATGAGTTTTCCATCTCTATCATGCGAGTTTGCATCTCT...

Protein

Download Protein FASTA

432 aa · TkAUNG094630|TK1151|PROTEIN

MFLTAKIKSVDFFRKIPRDLTEASLSGAGLSIMAAFSMMFLFGMELQNYLTMSTTTSVIVDQSSDSEILLIGFNMSFPSLSCEFASLDVSDVLARNRLNVTKTIRKYSINKHLQTKGPEFESTPVFTIIKHDDKVDEEYIEGSVSLNSQNFDEISNRHSILVVNFFAPWCYWSNRMCFIYLFVHFVLITRHDPKTDGRIILGKVDCTQDTDLCRRHHIQGYPSIRIFRKASDIRIRDGKKGHHDHESYYGDRDIDSLVKV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG094630`
TK1151 ID	TkAUNG094630
OH-1004 ID	LXL04_030954
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	88.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG094630

Location ChrUn:26756420-26761409 (+)

Description Similar to PDIL5-4: Protein disulfide isomerase-like 5-4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g27080`	Acts as a protein-folding catalyst that interacts with nascent polypeptides to catalyze the formation, isomerization, and reduction or oxidation of disulfide bonds.	No verified direct reference in this release
`At3g20560`	Acts as a protein-folding catalyst that interacts with nascent polypeptides to catalyze the formation, isomerization, and reduction or oxidation of disulfide bonds.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os07g0524100`	Acts as a protein-folding catalyst that interacts with nascent polypeptides to catalyze the formation, isomerization, and reduction or oxidation of disulfide bonds.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030954 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport Biological Process

GO:0006890 retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum Biological Process

GO:0090316 positive regulation of intracellular protein transport Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0030134 COPII-coated ER to Golgi transport vesicle Cellular Component

GO:0033116 endoplasmic reticulum-Golgi intermediate compartment membrane Cellular Component

GO:0003756 protein disulfide isomerase activity Molecular Function

KEGG gene cross-reference

ath:AT3G20560

ath:AT4G27080

dosa:Os07g0524100

hsa:51614

pon:100173087

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.732

Rank 1 · TkAUNG094630 · TK1151

Golgi apparatus0.168

Rank 2 · TkAUNG094630 · TK1151

Cytoplasm0.095

Rank 3 · TkAUNG094630 · TK1151

Nucleus0.090

Rank 4 · TkAUNG094630 · TK1151

Cell membrane0.063

Rank 5 · TkAUNG094630 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13850ERGIC_N7-96 aa

PF07970COPIIcoated_ERV91-117 aa

PF00085Thioredoxin121-136 aa

PF00085Thioredoxin144-240 aa

PF07970COPIIcoated_ERV272-413 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG094630	`PF13850`	ERGIC_N	7	96	7.9e-21	74.7
TkAUNG094630	`PF07970`	COPIIcoated_ERV	91	117	1.2e-17	65.2
TkAUNG094630	`PF00085`	Thioredoxin	121	136	9.2e-11	42.4
TkAUNG094630	`PF00085`	Thioredoxin	144	240	9.2e-11	42.4
TkAUNG094630	`PF07970`	COPIIcoated_ERV	272	413	1.2e-17	65.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9T042`	Arabidopsis thaliana	sp\|Q9T042\|PDI54_ARATH Protein disulfide-isomerase 5-4	56.100%	Swiss-Prot	High
`Q9LJU2`	Arabidopsis thaliana	sp\|Q9LJU2\|PDI53_ARATH Protein disulfide-isomerase 5-3	54.800%	Swiss-Prot	High
`Q69SA9`	Oryza sativa subsp. japonica	sp\|Q69SA9\|PDI54_ORYSJ Protein disulfide isomerase-like 5-4	57.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card